diff options
86 files changed, 24891 insertions, 0 deletions
diff --git a/docs/openvg.html b/docs/openvg.html new file mode 100644 index 0000000000..a8153b9db9 --- /dev/null +++ b/docs/openvg.html @@ -0,0 +1,48 @@ +<HTML> + +<TITLE>Mesa Release Notes</TITLE> + +<head><link rel="stylesheet" type="text/css" href="mesa.css"></head> + +<BODY> + +<body bgcolor="#eeeeee"> + +<H1>OpenVG State Tracker</H1> + +<p> +The current version of the OpenVG state tracker implements OpenVG 1.0. +</p> +<p> +More informations about OpenVG can be found at <a href="http://www.khronos.org/openvg/">http://www.khronos.org/openvg/</a> . +</p> +<p> +The OpenVG state tracker depends on the Gallium architecture and a working EGL implementation. +</p> + + +<h2>Building the library</h2> +<ol> +<li>Build Mesa3D with Gallium3D. Any build that builds Gallium3D libraries and EGL will suffice</li> +<li>cd src/gallium/state_trackers/vega; make</li> +<li>The last step will build libOpenVG library. You can add the libdir to LD_LIBRARY_PATH or install libOpenVG</li> +</ol> + +<h3>Sample build</h3> +A sample build looks as follows: +<pre> +make linux-x86-64-debug +cd src/gallium/state_trackers/vega +make +cd ../../../.. +export LD_LIBRARY_PATH=$PWD/lib64 +export EGL_DRIVER="egl_softpipe" +</pre> + +<h2>Notes</h2> +<ul> +<li>EGL_DRIVER environmental variable: forces usage of a specific EGL driver. Unless you force egl_softpipe the implementation will look for a DRI hardware accelerate driver and unless you have a Gallium driver that supports it, you'll see crashes</li> +</ul> + +</body> +</html> diff --git a/include/VG/openvg.h b/include/VG/openvg.h new file mode 100644 index 0000000000..60167e45d6 --- /dev/null +++ b/include/VG/openvg.h @@ -0,0 +1,686 @@ +/* $Revision: 6822 $ on $Date:: 2008-10-30 05:14:19 -0400 #$ */ + +/*------------------------------------------------------------------------ + * + * OpenVG 1.0.1 Reference Implementation + * ------------------------------------- + * + * Copyright (c) 2008 The Khronos Group Inc. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and /or associated documentation files + * (the "Materials "), to deal in the Materials without restriction, + * including without limitation the rights to use, copy, modify, merge, + * publish, distribute, sublicense, and/or sell copies of the Materials, + * and to permit persons to whom the Materials are furnished to do so, + * subject to the following conditions: + * + * The above copyright notice and this permission notice shall be included + * in all copies or substantial portions of the Materials. + * + * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, + * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. + * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, + * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR + * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR + * THE USE OR OTHER DEALINGS IN THE MATERIALS. + * + *//** + * \file + * \brief OpenVG 1.0.1 API. + *//*-------------------------------------------------------------------*/ + +#ifndef _OPENVG_H +#define _OPENVG_H + +#include <VG/vgplatform.h> + +#ifdef __cplusplus +extern "C" { +#endif + +#define OPENVG_VERSION_1_0 1 +#define OPENVG_VERSION_1_0_1 1 + +#ifndef VG_MAXSHORT +#define VG_MAXSHORT 0x7FFF +#endif + +#ifndef VG_MAXINT +#define VG_MAXINT 0x7FFFFFFF +#endif + +#ifndef VG_MAX_ENUM +#define VG_MAX_ENUM 0x7FFFFFFF +#endif + +typedef long VGHandle; + +typedef VGHandle VGPath; +typedef VGHandle VGImage; +typedef VGHandle VGPaint; + +#define VG_INVALID_HANDLE ((VGHandle)0) + +typedef enum { + VG_FALSE = 0, + VG_TRUE = 1, + + VG_BOOLEAN_FORCE_SIZE = VG_MAX_ENUM +} VGboolean; + +typedef enum { + VG_NO_ERROR = 0, + VG_BAD_HANDLE_ERROR = 0x1000, + VG_ILLEGAL_ARGUMENT_ERROR = 0x1001, + VG_OUT_OF_MEMORY_ERROR = 0x1002, + VG_PATH_CAPABILITY_ERROR = 0x1003, + VG_UNSUPPORTED_IMAGE_FORMAT_ERROR = 0x1004, + VG_UNSUPPORTED_PATH_FORMAT_ERROR = 0x1005, + VG_IMAGE_IN_USE_ERROR = 0x1006, + VG_NO_CONTEXT_ERROR = 0x1007, + + VG_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM +} VGErrorCode; + +typedef enum { + /* Mode settings */ + VG_MATRIX_MODE = 0x1100, + VG_FILL_RULE = 0x1101, + VG_IMAGE_QUALITY = 0x1102, + VG_RENDERING_QUALITY = 0x1103, + VG_BLEND_MODE = 0x1104, + VG_IMAGE_MODE = 0x1105, + + /* Scissoring rectangles */ + VG_SCISSOR_RECTS = 0x1106, + + /* Stroke parameters */ + VG_STROKE_LINE_WIDTH = 0x1110, + VG_STROKE_CAP_STYLE = 0x1111, + VG_STROKE_JOIN_STYLE = 0x1112, + VG_STROKE_MITER_LIMIT = 0x1113, + VG_STROKE_DASH_PATTERN = 0x1114, + VG_STROKE_DASH_PHASE = 0x1115, + VG_STROKE_DASH_PHASE_RESET = 0x1116, + + /* Edge fill color for VG_TILE_FILL tiling mode */ + VG_TILE_FILL_COLOR = 0x1120, + + /* Color for vgClear */ + VG_CLEAR_COLOR = 0x1121, + + /* Enable/disable alpha masking and scissoring */ + VG_MASKING = 0x1130, + VG_SCISSORING = 0x1131, + + /* Pixel layout information */ + VG_PIXEL_LAYOUT = 0x1140, + VG_SCREEN_LAYOUT = 0x1141, + + /* Source format selection for image filters */ + VG_FILTER_FORMAT_LINEAR = 0x1150, + VG_FILTER_FORMAT_PREMULTIPLIED = 0x1151, + + /* Destination write enable mask for image filters */ + VG_FILTER_CHANNEL_MASK = 0x1152, + + /* Implementation limits (read-only) */ + VG_MAX_SCISSOR_RECTS = 0x1160, + VG_MAX_DASH_COUNT = 0x1161, + VG_MAX_KERNEL_SIZE = 0x1162, + VG_MAX_SEPARABLE_KERNEL_SIZE = 0x1163, + VG_MAX_COLOR_RAMP_STOPS = 0x1164, + VG_MAX_IMAGE_WIDTH = 0x1165, + VG_MAX_IMAGE_HEIGHT = 0x1166, + VG_MAX_IMAGE_PIXELS = 0x1167, + VG_MAX_IMAGE_BYTES = 0x1168, + VG_MAX_FLOAT = 0x1169, + VG_MAX_GAUSSIAN_STD_DEVIATION = 0x116A, + + VG_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGParamType; + +typedef enum { + VG_RENDERING_QUALITY_NONANTIALIASED = 0x1200, + VG_RENDERING_QUALITY_FASTER = 0x1201, + VG_RENDERING_QUALITY_BETTER = 0x1202, /* Default */ + + VG_RENDERING_QUALITY_FORCE_SIZE = VG_MAX_ENUM +} VGRenderingQuality; + +typedef enum { + VG_PIXEL_LAYOUT_UNKNOWN = 0x1300, + VG_PIXEL_LAYOUT_RGB_VERTICAL = 0x1301, + VG_PIXEL_LAYOUT_BGR_VERTICAL = 0x1302, + VG_PIXEL_LAYOUT_RGB_HORIZONTAL = 0x1303, + VG_PIXEL_LAYOUT_BGR_HORIZONTAL = 0x1304, + + VG_PIXEL_LAYOUT_FORCE_SIZE = VG_MAX_ENUM +} VGPixelLayout; + +typedef enum { + VG_MATRIX_PATH_USER_TO_SURFACE = 0x1400, + VG_MATRIX_IMAGE_USER_TO_SURFACE = 0x1401, + VG_MATRIX_FILL_PAINT_TO_USER = 0x1402, + VG_MATRIX_STROKE_PAINT_TO_USER = 0x1403, + + VG_MATRIX_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGMatrixMode; + +typedef enum { + VG_CLEAR_MASK = 0x1500, + VG_FILL_MASK = 0x1501, + VG_SET_MASK = 0x1502, + VG_UNION_MASK = 0x1503, + VG_INTERSECT_MASK = 0x1504, + VG_SUBTRACT_MASK = 0x1505, + + VG_MASK_OPERATION_FORCE_SIZE = VG_MAX_ENUM +} VGMaskOperation; + +#define VG_PATH_FORMAT_STANDARD 0 + +typedef enum { + VG_PATH_DATATYPE_S_8 = 0, + VG_PATH_DATATYPE_S_16 = 1, + VG_PATH_DATATYPE_S_32 = 2, + VG_PATH_DATATYPE_F = 3, + + VG_PATH_DATATYPE_FORCE_SIZE = VG_MAX_ENUM +} VGPathDatatype; + +typedef enum { + VG_ABSOLUTE = 0, + VG_RELATIVE = 1, + + VG_PATH_ABS_REL_FORCE_SIZE = VG_MAX_ENUM +} VGPathAbsRel; + +typedef enum { + VG_CLOSE_PATH = ( 0 << 1), + VG_MOVE_TO = ( 1 << 1), + VG_LINE_TO = ( 2 << 1), + VG_HLINE_TO = ( 3 << 1), + VG_VLINE_TO = ( 4 << 1), + VG_QUAD_TO = ( 5 << 1), + VG_CUBIC_TO = ( 6 << 1), + VG_SQUAD_TO = ( 7 << 1), + VG_SCUBIC_TO = ( 8 << 1), + VG_SCCWARC_TO = ( 9 << 1), + VG_SCWARC_TO = (10 << 1), + VG_LCCWARC_TO = (11 << 1), + VG_LCWARC_TO = (12 << 1), + + VG_PATH_SEGMENT_FORCE_SIZE = VG_MAX_ENUM +} VGPathSegment; + +typedef enum { + VG_MOVE_TO_ABS = VG_MOVE_TO | VG_ABSOLUTE, + VG_MOVE_TO_REL = VG_MOVE_TO | VG_RELATIVE, + VG_LINE_TO_ABS = VG_LINE_TO | VG_ABSOLUTE, + VG_LINE_TO_REL = VG_LINE_TO | VG_RELATIVE, + VG_HLINE_TO_ABS = VG_HLINE_TO | VG_ABSOLUTE, + VG_HLINE_TO_REL = VG_HLINE_TO | VG_RELATIVE, + VG_VLINE_TO_ABS = VG_VLINE_TO | VG_ABSOLUTE, + VG_VLINE_TO_REL = VG_VLINE_TO | VG_RELATIVE, + VG_QUAD_TO_ABS = VG_QUAD_TO | VG_ABSOLUTE, + VG_QUAD_TO_REL = VG_QUAD_TO | VG_RELATIVE, + VG_CUBIC_TO_ABS = VG_CUBIC_TO | VG_ABSOLUTE, + VG_CUBIC_TO_REL = VG_CUBIC_TO | VG_RELATIVE, + VG_SQUAD_TO_ABS = VG_SQUAD_TO | VG_ABSOLUTE, + VG_SQUAD_TO_REL = VG_SQUAD_TO | VG_RELATIVE, + VG_SCUBIC_TO_ABS = VG_SCUBIC_TO | VG_ABSOLUTE, + VG_SCUBIC_TO_REL = VG_SCUBIC_TO | VG_RELATIVE, + VG_SCCWARC_TO_ABS = VG_SCCWARC_TO | VG_ABSOLUTE, + VG_SCCWARC_TO_REL = VG_SCCWARC_TO | VG_RELATIVE, + VG_SCWARC_TO_ABS = VG_SCWARC_TO | VG_ABSOLUTE, + VG_SCWARC_TO_REL = VG_SCWARC_TO | VG_RELATIVE, + VG_LCCWARC_TO_ABS = VG_LCCWARC_TO | VG_ABSOLUTE, + VG_LCCWARC_TO_REL = VG_LCCWARC_TO | VG_RELATIVE, + VG_LCWARC_TO_ABS = VG_LCWARC_TO | VG_ABSOLUTE, + VG_LCWARC_TO_REL = VG_LCWARC_TO | VG_RELATIVE, + + VG_PATH_COMMAND_FORCE_SIZE = VG_MAX_ENUM +} VGPathCommand; + +typedef enum { + VG_PATH_CAPABILITY_APPEND_FROM = (1 << 0), + VG_PATH_CAPABILITY_APPEND_TO = (1 << 1), + VG_PATH_CAPABILITY_MODIFY = (1 << 2), + VG_PATH_CAPABILITY_TRANSFORM_FROM = (1 << 3), + VG_PATH_CAPABILITY_TRANSFORM_TO = (1 << 4), + VG_PATH_CAPABILITY_INTERPOLATE_FROM = (1 << 5), + VG_PATH_CAPABILITY_INTERPOLATE_TO = (1 << 6), + VG_PATH_CAPABILITY_PATH_LENGTH = (1 << 7), + VG_PATH_CAPABILITY_POINT_ALONG_PATH = (1 << 8), + VG_PATH_CAPABILITY_TANGENT_ALONG_PATH = (1 << 9), + VG_PATH_CAPABILITY_PATH_BOUNDS = (1 << 10), + VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS = (1 << 11), + VG_PATH_CAPABILITY_ALL = (1 << 12) - 1, + + VG_PATH_CAPABILITIES_FORCE_SIZE = VG_MAX_ENUM +} VGPathCapabilities; + +typedef enum { + VG_PATH_FORMAT = 0x1600, + VG_PATH_DATATYPE = 0x1601, + VG_PATH_SCALE = 0x1602, + VG_PATH_BIAS = 0x1603, + VG_PATH_NUM_SEGMENTS = 0x1604, + VG_PATH_NUM_COORDS = 0x1605, + + VG_PATH_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGPathParamType; + +typedef enum { + VG_CAP_BUTT = 0x1700, + VG_CAP_ROUND = 0x1701, + VG_CAP_SQUARE = 0x1702, + + VG_CAP_STYLE_FORCE_SIZE = VG_MAX_ENUM +} VGCapStyle; + +typedef enum { + VG_JOIN_MITER = 0x1800, + VG_JOIN_ROUND = 0x1801, + VG_JOIN_BEVEL = 0x1802, + + VG_JOIN_STYLE_FORCE_SIZE = VG_MAX_ENUM +} VGJoinStyle; + +typedef enum { + VG_EVEN_ODD = 0x1900, + VG_NON_ZERO = 0x1901, + + VG_FILL_RULE_FORCE_SIZE = VG_MAX_ENUM +} VGFillRule; + +typedef enum { + VG_STROKE_PATH = (1 << 0), + VG_FILL_PATH = (1 << 1), + + VG_PAINT_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGPaintMode; + +typedef enum { + /* Color paint parameters */ + VG_PAINT_TYPE = 0x1A00, + VG_PAINT_COLOR = 0x1A01, + VG_PAINT_COLOR_RAMP_SPREAD_MODE = 0x1A02, + VG_PAINT_COLOR_RAMP_PREMULTIPLIED = 0x1A07, + VG_PAINT_COLOR_RAMP_STOPS = 0x1A03, + + /* Linear gradient paint parameters */ + VG_PAINT_LINEAR_GRADIENT = 0x1A04, + + /* Radial gradient paint parameters */ + VG_PAINT_RADIAL_GRADIENT = 0x1A05, + + /* Pattern paint parameters */ + VG_PAINT_PATTERN_TILING_MODE = 0x1A06, + + VG_PAINT_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGPaintParamType; + +typedef enum { + VG_PAINT_TYPE_COLOR = 0x1B00, + VG_PAINT_TYPE_LINEAR_GRADIENT = 0x1B01, + VG_PAINT_TYPE_RADIAL_GRADIENT = 0x1B02, + VG_PAINT_TYPE_PATTERN = 0x1B03, + + VG_PAINT_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGPaintType; + +typedef enum { + VG_COLOR_RAMP_SPREAD_PAD = 0x1C00, + VG_COLOR_RAMP_SPREAD_REPEAT = 0x1C01, + VG_COLOR_RAMP_SPREAD_REFLECT = 0x1C02, + + VG_COLOR_RAMP_SPREAD_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGColorRampSpreadMode; + +typedef enum { + VG_TILE_FILL = 0x1D00, + VG_TILE_PAD = 0x1D01, + VG_TILE_REPEAT = 0x1D02, + VG_TILE_REFLECT = 0x1D03, + + VG_TILING_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGTilingMode; + +typedef enum { + /* RGB{A,X} channel ordering */ + VG_sRGBX_8888 = 0, + VG_sRGBA_8888 = 1, + VG_sRGBA_8888_PRE = 2, + VG_sRGB_565 = 3, + VG_sRGBA_5551 = 4, + VG_sRGBA_4444 = 5, + VG_sL_8 = 6, + VG_lRGBX_8888 = 7, + VG_lRGBA_8888 = 8, + VG_lRGBA_8888_PRE = 9, + VG_lL_8 = 10, + VG_A_8 = 11, + VG_BW_1 = 12, + + /* {A,X}RGB channel ordering */ + VG_sXRGB_8888 = 0 | (1 << 6), + VG_sARGB_8888 = 1 | (1 << 6), + VG_sARGB_8888_PRE = 2 | (1 << 6), + VG_sARGB_1555 = 4 | (1 << 6), + VG_sARGB_4444 = 5 | (1 << 6), + VG_lXRGB_8888 = 7 | (1 << 6), + VG_lARGB_8888 = 8 | (1 << 6), + VG_lARGB_8888_PRE = 9 | (1 << 6), + + /* BGR{A,X} channel ordering */ + VG_sBGRX_8888 = 0 | (1 << 7), + VG_sBGRA_8888 = 1 | (1 << 7), + VG_sBGRA_8888_PRE = 2 | (1 << 7), + VG_sBGR_565 = 3 | (1 << 7), + VG_sBGRA_5551 = 4 | (1 << 7), + VG_sBGRA_4444 = 5 | (1 << 7), + VG_lBGRX_8888 = 7 | (1 << 7), + VG_lBGRA_8888 = 8 | (1 << 7), + VG_lBGRA_8888_PRE = 9 | (1 << 7), + + /* {A,X}BGR channel ordering */ + VG_sXBGR_8888 = 0 | (1 << 6) | (1 << 7), + VG_sABGR_8888 = 1 | (1 << 6) | (1 << 7), + VG_sABGR_8888_PRE = 2 | (1 << 6) | (1 << 7), + VG_sABGR_1555 = 4 | (1 << 6) | (1 << 7), + VG_sABGR_4444 = 5 | (1 << 6) | (1 << 7), + VG_lXBGR_8888 = 7 | (1 << 6) | (1 << 7), + VG_lABGR_8888 = 8 | (1 << 6) | (1 << 7), + VG_lABGR_8888_PRE = 9 | (1 << 6) | (1 << 7), + + VG_IMAGE_FORMAT_FORCE_SIZE = VG_MAX_ENUM +} VGImageFormat; + +typedef enum { + VG_IMAGE_QUALITY_NONANTIALIASED = (1 << 0), + VG_IMAGE_QUALITY_FASTER = (1 << 1), + VG_IMAGE_QUALITY_BETTER = (1 << 2), + + VG_IMAGE_QUALITY_FORCE_SIZE = VG_MAX_ENUM +} VGImageQuality; + +typedef enum { + VG_IMAGE_FORMAT = 0x1E00, + VG_IMAGE_WIDTH = 0x1E01, + VG_IMAGE_HEIGHT = 0x1E02, + + VG_IMAGE_PARAM_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGImageParamType; + +typedef enum { + VG_DRAW_IMAGE_NORMAL = 0x1F00, + VG_DRAW_IMAGE_MULTIPLY = 0x1F01, + VG_DRAW_IMAGE_STENCIL = 0x1F02, + + VG_IMAGE_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGImageMode; + +typedef enum { + VG_RED = (1 << 3), + VG_GREEN = (1 << 2), + VG_BLUE = (1 << 1), + VG_ALPHA = (1 << 0), + + VG_IMAGE_CHANNEL_FORCE_SIZE = VG_MAX_ENUM +} VGImageChannel; + +typedef enum { + VG_BLEND_SRC = 0x2000, + VG_BLEND_SRC_OVER = 0x2001, + VG_BLEND_DST_OVER = 0x2002, + VG_BLEND_SRC_IN = 0x2003, + VG_BLEND_DST_IN = 0x2004, + VG_BLEND_MULTIPLY = 0x2005, + VG_BLEND_SCREEN = 0x2006, + VG_BLEND_DARKEN = 0x2007, + VG_BLEND_LIGHTEN = 0x2008, + VG_BLEND_ADDITIVE = 0x2009, + + VG_BLEND_MODE_FORCE_SIZE = VG_MAX_ENUM +} VGBlendMode; + +typedef enum { + VG_IMAGE_FORMAT_QUERY = 0x2100, + VG_PATH_DATATYPE_QUERY = 0x2101, + + VG_HARDWARE_QUERY_TYPE_FORCE_SIZE = VG_MAX_ENUM +} VGHardwareQueryType; + +typedef enum { + VG_HARDWARE_ACCELERATED = 0x2200, + VG_HARDWARE_UNACCELERATED = 0x2201, + + VG_HARDWARE_QUERY_RESULT_FORCE_SIZE = VG_MAX_ENUM +} VGHardwareQueryResult; + +typedef enum { + VG_VENDOR = 0x2300, + VG_RENDERER = 0x2301, + VG_VERSION = 0x2302, + VG_EXTENSIONS = 0x2303, + + VG_STRING_ID_FORCE_SIZE = VG_MAX_ENUM +} VGStringID; + +/* Function Prototypes */ + +#ifndef VG_API_CALL +# error VG_API_CALL must be defined +#endif + +#ifndef VG_API_ENTRY +# error VG_API_ENTRY must be defined +#endif + +#ifndef VG_API_EXIT +# error VG_API_EXIT must be defined +#endif + +VG_API_CALL VGErrorCode VG_API_ENTRY vgGetError(void) VG_API_EXIT; + +VG_API_CALL void VG_API_ENTRY vgFlush(void) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgFinish(void) VG_API_EXIT; + +/* Getters and Setters */ +VG_API_CALL void VG_API_ENTRY vgSetf (VGParamType type, VGfloat value) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSeti (VGParamType type, VGint value) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetfv(VGParamType type, VGint count, + const VGfloat * values) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetiv(VGParamType type, VGint count, + const VGint * values) VG_API_EXIT; + +VG_API_CALL VGfloat VG_API_ENTRY vgGetf(VGParamType type) VG_API_EXIT; +VG_API_CALL VGint VG_API_ENTRY vgGeti(VGParamType type) VG_API_EXIT; +VG_API_CALL VGint VG_API_ENTRY vgGetVectorSize(VGParamType type) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetfv(VGParamType type, VGint count, VGfloat * values) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetiv(VGParamType type, VGint count, VGint * values) VG_API_EXIT; + +VG_API_CALL void VG_API_ENTRY vgSetParameterf(VGHandle object, + VGint paramType, + VGfloat value) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetParameteri(VGHandle object, + VGint paramType, + VGint value) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetParameterfv(VGHandle object, + VGint paramType, + VGint count, const VGfloat * values) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetParameteriv(VGHandle object, + VGint paramType, + VGint count, const VGint * values) VG_API_EXIT; + +VG_API_CALL VGfloat VG_API_ENTRY vgGetParameterf(VGHandle object, + VGint paramType) VG_API_EXIT; +VG_API_CALL VGint VG_API_ENTRY vgGetParameteri(VGHandle object, + VGint paramType); +VG_API_CALL VGint VG_API_ENTRY vgGetParameterVectorSize(VGHandle object, + VGint paramType) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetParameterfv(VGHandle object, + VGint paramType, + VGint count, VGfloat * values) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetParameteriv(VGHandle object, + VGint paramType, + VGint count, VGint * values) VG_API_EXIT; + +/* Matrix Manipulation */ +VG_API_CALL void VG_API_ENTRY vgLoadIdentity(void) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgLoadMatrix(const VGfloat * m) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetMatrix(VGfloat * m) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgMultMatrix(const VGfloat * m) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgTranslate(VGfloat tx, VGfloat ty) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgScale(VGfloat sx, VGfloat sy) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgShear(VGfloat shx, VGfloat shy) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgRotate(VGfloat angle) VG_API_EXIT; + +/* Masking and Clearing */ +VG_API_CALL void VG_API_ENTRY vgMask(VGImage mask, VGMaskOperation operation, + VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgClear(VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; + +/* Paths */ +VG_API_CALL VGPath VG_API_ENTRY vgCreatePath(VGint pathFormat, + VGPathDatatype datatype, + VGfloat scale, VGfloat bias, + VGint segmentCapacityHint, + VGint coordCapacityHint, + VGbitfield capabilities) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgClearPath(VGPath path, VGbitfield capabilities) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDestroyPath(VGPath path) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgRemovePathCapabilities(VGPath path, + VGbitfield capabilities) VG_API_EXIT; +VG_API_CALL VGbitfield VG_API_ENTRY vgGetPathCapabilities(VGPath path) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgAppendPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgAppendPathData(VGPath dstPath, + VGint numSegments, + const VGubyte * pathSegments, + const void * pathData) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgModifyPathCoords(VGPath dstPath, VGint startIndex, + VGint numSegments, + const void * pathData) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgTransformPath(VGPath dstPath, VGPath srcPath) VG_API_EXIT; +VG_API_CALL VGboolean VG_API_ENTRY vgInterpolatePath(VGPath dstPath, + VGPath startPath, + VGPath endPath, + VGfloat amount) VG_API_EXIT; +VG_API_CALL VGfloat VG_API_ENTRY vgPathLength(VGPath path, + VGint startSegment, VGint numSegments) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgPointAlongPath(VGPath path, + VGint startSegment, VGint numSegments, + VGfloat distance, + VGfloat * x, VGfloat * y, + VGfloat * tangentX, VGfloat * tangentY) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgPathBounds(VGPath path, + VGfloat * minX, VGfloat * minY, + VGfloat * width, VGfloat * height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgPathTransformedBounds(VGPath path, + VGfloat * minX, VGfloat * minY, + VGfloat * width, VGfloat * height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDrawPath(VGPath path, VGbitfield paintModes) VG_API_EXIT; + +/* Paint */ +VG_API_CALL VGPaint VG_API_ENTRY vgCreatePaint(void) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDestroyPaint(VGPaint paint) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetPaint(VGPaint paint, VGbitfield paintModes) VG_API_EXIT; +VG_API_CALL VGPaint VG_API_ENTRY vgGetPaint(VGPaintMode paintMode) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetColor(VGPaint paint, VGuint rgba) VG_API_EXIT; +VG_API_CALL VGuint VG_API_ENTRY vgGetColor(VGPaint paint) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgPaintPattern(VGPaint paint, VGImage pattern) VG_API_EXIT; + +/* Images */ +VG_API_CALL VGImage VG_API_ENTRY vgCreateImage(VGImageFormat format, + VGint width, VGint height, + VGbitfield allowedQuality) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDestroyImage(VGImage image) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgClearImage(VGImage image, + VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgImageSubData(VGImage image, + const void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetImageSubData(VGImage image, + void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL VGImage VG_API_ENTRY vgChildImage(VGImage parent, + VGint x, VGint y, VGint width, VGint height) VG_API_EXIT; +VG_API_CALL VGImage VG_API_ENTRY vgGetParent(VGImage image) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgCopyImage(VGImage dst, VGint dx, VGint dy, + VGImage src, VGint sx, VGint sy, + VGint width, VGint height, + VGboolean dither) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgDrawImage(VGImage image) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSetPixels(VGint dx, VGint dy, + VGImage src, VGint sx, VGint sy, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgWritePixels(const void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint dx, VGint dy, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGetPixels(VGImage dst, VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgReadPixels(void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint sx, VGint sy, + VGint width, VGint height) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgCopyPixels(VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) VG_API_EXIT; + +/* Image Filters */ +VG_API_CALL void VG_API_ENTRY vgColorMatrix(VGImage dst, VGImage src, + const VGfloat * matrix) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgConvolve(VGImage dst, VGImage src, + VGint kernelWidth, VGint kernelHeight, + VGint shiftX, VGint shiftY, + const VGshort * kernel, + VGfloat scale, + VGfloat bias, + VGTilingMode tilingMode) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgSeparableConvolve(VGImage dst, VGImage src, + VGint kernelWidth, + VGint kernelHeight, + VGint shiftX, VGint shiftY, + const VGshort * kernelX, + const VGshort * kernelY, + VGfloat scale, + VGfloat bias, + VGTilingMode tilingMode) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgGaussianBlur(VGImage dst, VGImage src, + VGfloat stdDeviationX, + VGfloat stdDeviationY, + VGTilingMode tilingMode) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgLookup(VGImage dst, VGImage src, + const VGubyte * redLUT, + const VGubyte * greenLUT, + const VGubyte * blueLUT, + const VGubyte * alphaLUT, + VGboolean outputLinear, + VGboolean outputPremultiplied) VG_API_EXIT; +VG_API_CALL void VG_API_ENTRY vgLookupSingle(VGImage dst, VGImage src, + const VGuint * lookupTable, + VGImageChannel sourceChannel, + VGboolean outputLinear, + VGboolean outputPremultiplied) VG_API_EXIT; + +/* Hardware Queries */ +VG_API_CALL VGHardwareQueryResult VG_API_ENTRY vgHardwareQuery(VGHardwareQueryType key, + VGint setting) VG_API_EXIT; + +/* Renderer and Extension Information */ +VG_API_CALL const VGubyte * VG_API_ENTRY vgGetString(VGStringID name) VG_API_EXIT; + +#ifdef __cplusplus +} /* extern "C" */ +#endif + +#endif /* _OPENVG_H */ diff --git a/include/VG/vgext.h b/include/VG/vgext.h new file mode 100644 index 0000000000..97e3e779e1 --- /dev/null +++ b/include/VG/vgext.h @@ -0,0 +1,233 @@ +/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * VG extensions Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Materials.
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief VG extensions
+ *//*-------------------------------------------------------------------*/
+
+
+
+#ifndef _VGEXT_H
+#define _VGEXT_H
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#include <VG/openvg.h>
+#include <VG/vgu.h>
+
+#ifndef VG_API_ENTRYP
+# define VG_API_ENTRYP VG_API_ENTRY*
+#endif
+
+#ifndef VGU_API_ENTRYP
+# define VGU_API_ENTRYP VGU_API_ENTRY*
+#endif
+
+/*-------------------------------------------------------------------------------
+ * KHR extensions
+ *------------------------------------------------------------------------------*/
+
+typedef enum {
+
+#ifndef VG_KHR_iterative_average_blur
+ VG_MAX_AVERAGE_BLUR_DIMENSION_KHR = 0x116B,
+ VG_AVERAGE_BLUR_DIMENSION_RESOLUTION_KHR = 0x116C,
+ VG_MAX_AVERAGE_BLUR_ITERATIONS_KHR = 0x116D,
+#endif
+
+ VG_PARAM_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
+} VGParamTypeKHR;
+
+#ifndef VG_KHR_EGL_image
+#define VG_KHR_EGL_image 1
+/* VGEGLImageKHR is an opaque handle to an EGLImage */
+typedef void* VGeglImageKHR;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL VGImage VG_API_ENTRY vgCreateEGLImageTargetKHR(VGeglImageKHR image);
+#endif
+typedef VGImage (VG_API_ENTRYP PFNVGCREATEEGLIMAGETARGETKHRPROC) (VGeglImageKHR image);
+
+#endif
+
+
+#ifndef VG_KHR_iterative_average_blur
+#define VG_KHR_iterative_average_blur 1
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void vgIterativeAverageBlurKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
+#endif
+typedef void (VG_API_ENTRYP PFNVGITERATIVEAVERAGEBLURKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGTilingMode tilingMode);
+
+#endif
+
+
+#ifndef VG_KHR_advanced_blending
+#define VG_KHR_advanced_blending 1
+
+typedef enum {
+ VG_BLEND_OVERLAY_KHR = 0x2010,
+ VG_BLEND_HARDLIGHT_KHR = 0x2011,
+ VG_BLEND_SOFTLIGHT_SVG_KHR = 0x2012,
+ VG_BLEND_SOFTLIGHT_KHR = 0x2013,
+ VG_BLEND_COLORDODGE_KHR = 0x2014,
+ VG_BLEND_COLORBURN_KHR = 0x2015,
+ VG_BLEND_DIFFERENCE_KHR = 0x2016,
+ VG_BLEND_SUBTRACT_KHR = 0x2017,
+ VG_BLEND_INVERT_KHR = 0x2018,
+ VG_BLEND_EXCLUSION_KHR = 0x2019,
+ VG_BLEND_LINEARDODGE_KHR = 0x201a,
+ VG_BLEND_LINEARBURN_KHR = 0x201b,
+ VG_BLEND_VIVIDLIGHT_KHR = 0x201c,
+ VG_BLEND_LINEARLIGHT_KHR = 0x201d,
+ VG_BLEND_PINLIGHT_KHR = 0x201e,
+ VG_BLEND_HARDMIX_KHR = 0x201f,
+ VG_BLEND_CLEAR_KHR = 0x2020,
+ VG_BLEND_DST_KHR = 0x2021,
+ VG_BLEND_SRC_OUT_KHR = 0x2022,
+ VG_BLEND_DST_OUT_KHR = 0x2023,
+ VG_BLEND_SRC_ATOP_KHR = 0x2024,
+ VG_BLEND_DST_ATOP_KHR = 0x2025,
+ VG_BLEND_XOR_KHR = 0x2026,
+
+ VG_BLEND_MODE_KHR_FORCE_SIZE= VG_MAX_ENUM
+} VGBlendModeKHR;
+#endif
+
+#ifndef VG_KHR_parametric_filter
+#define VG_KHR_parametric_filter 1
+
+typedef enum {
+ VG_PF_OBJECT_VISIBLE_FLAG_KHR = (1 << 0),
+ VG_PF_KNOCKOUT_FLAG_KHR = (1 << 1),
+ VG_PF_OUTER_FLAG_KHR = (1 << 2),
+ VG_PF_INNER_FLAG_KHR = (1 << 3),
+
+ VG_PF_TYPE_KHR_FORCE_SIZE = VG_MAX_ENUM
+} VGPfTypeKHR;
+
+typedef enum {
+ VGU_IMAGE_IN_USE_ERROR = 0xF010,
+
+ VGU_ERROR_CODE_KHR_FORCE_SIZE = VG_MAX_ENUM
+} VGUErrorCodeKHR;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void VG_API_ENTRY vgParametricFilterKHR(VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguDropShadowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA) ;
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientGlowKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguGradientBevelKHR(VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
+#endif
+typedef void (VG_API_ENTRYP PFNVGPARAMETRICFILTERKHRPROC) (VGImage dst,VGImage src,VGImage blur,VGfloat strength,VGfloat offsetX,VGfloat offsetY,VGbitfield filterFlags,VGPaint highlightPaint,VGPaint shadowPaint);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUDROPSHADOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint shadowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint glowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint highlightColorRGBA,VGuint shadowColorRGBA);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTGLOWKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* glowColorRampStops);
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUGRADIENTBEVELKHRPROC) (VGImage dst,VGImage src,VGfloat dimX,VGfloat dimY,VGuint iterative,VGfloat strength,VGfloat distance,VGfloat angle,VGbitfield filterFlags,VGbitfield allowedQuality,VGuint stopsCount,const VGfloat* bevelColorRampStops);
+
+#endif
+
+
+/*-------------------------------------------------------------------------------
+ * NDS extensions
+ *------------------------------------------------------------------------------*/
+
+#ifndef VG_NDS_paint_generation
+#define VG_NDS_paint_generation 1
+
+typedef enum {
+ VG_PAINT_COLOR_RAMP_LINEAR_NDS = 0x1A10,
+ VG_COLOR_MATRIX_NDS = 0x1A11,
+ VG_PAINT_COLOR_TRANSFORM_LINEAR_NDS = 0x1A12,
+
+ VG_PAINT_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPaintParamTypeNds;
+
+typedef enum {
+ VG_DRAW_IMAGE_COLOR_MATRIX_NDS = 0x1F10,
+
+ VG_IMAGE_MODE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGImageModeNds;
+#endif
+
+
+#ifndef VG_NDS_projective_geometry
+#define VG_NDS_projective_geometry 1
+
+typedef enum {
+ VG_CLIP_MODE_NDS = 0x1180,
+ VG_CLIP_LINES_NDS = 0x1181,
+ VG_MAX_CLIP_LINES_NDS = 0x1182,
+
+ VG_PARAM_TYPE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGParamTypeNds;
+
+typedef enum {
+ VG_CLIPMODE_NONE_NDS = 0x3000,
+ VG_CLIPMODE_CLIP_CLOSED_NDS = 0x3001,
+ VG_CLIPMODE_CLIP_OPEN_NDS = 0x3002,
+ VG_CLIPMODE_CULL_NDS = 0x3003,
+
+ VG_CLIPMODE_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGClipModeNds;
+
+typedef enum {
+ VG_RQUAD_TO_NDS = ( 13 << 1 ),
+ VG_RCUBIC_TO_NDS = ( 14 << 1 ),
+
+ VG_PATH_SEGMENT_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPathSegmentNds;
+
+typedef enum {
+ VG_RQUAD_TO_ABS_NDS = (VG_RQUAD_TO_NDS | VG_ABSOLUTE),
+ VG_RQUAD_TO_REL_NDS = (VG_RQUAD_TO_NDS | VG_RELATIVE),
+ VG_RCUBIC_TO_ABS_NDS = (VG_RCUBIC_TO_NDS | VG_ABSOLUTE),
+ VG_RCUBIC_TO_REL_NDS = (VG_RCUBIC_TO_NDS | VG_RELATIVE),
+
+ VG_PATH_COMMAND_NDS_FORCE_SIZE = VG_MAX_ENUM
+} VGPathCommandNds;
+
+#ifdef VG_VGEXT_PROTOTYPES
+VG_API_CALL void VG_API_ENTRY vgProjectiveMatrixNDS(VGboolean enable) ;
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguTransformClipLineNDS(const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
+#endif
+typedef void (VG_API_ENTRYP PFNVGPROJECTIVEMATRIXNDSPROC) (VGboolean enable) ;
+typedef VGUErrorCode (VGU_API_ENTRYP PFNVGUTRANSFORMCLIPLINENDSPROC) (const VGfloat Ain,const VGfloat Bin,const VGfloat Cin,const VGfloat* matrix,const VGboolean inverse,VGfloat* Aout,VGfloat* Bout,VGfloat* Cout);
+
+#endif
+
+#ifdef __cplusplus
+} /* extern "C" */
+#endif
+
+#endif /* _VGEXT_H */
diff --git a/include/VG/vgplatform.h b/include/VG/vgplatform.h new file mode 100644 index 0000000000..e4f269f658 --- /dev/null +++ b/include/VG/vgplatform.h @@ -0,0 +1,106 @@ +/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * VG platform specific header Reference Implementation
+ * ----------------------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Materials.
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief VG platform specific header
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _VGPLATFORM_H
+#define _VGPLATFORM_H
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#ifndef VG_API_CALL
+#if defined(OPENVG_STATIC_LIBRARY)
+# define VG_API_CALL
+#else
+# if defined(_WIN32) || defined(__VC32__) /* Win32 */
+# if defined (OPENVG_DLL_EXPORTS)
+# define VG_API_CALL __declspec(dllexport)
+# else
+# define VG_API_CALL __declspec(dllimport)
+# endif
+# else
+# define VG_API_CALL extern
+# endif /* defined(_WIN32) ||... */
+#endif /* defined OPENVG_STATIC_LIBRARY */
+#endif /* ifndef VG_API_CALL */
+
+#ifndef VGU_API_CALL
+#if defined(OPENVG_STATIC_LIBRARY)
+# define VGU_API_CALL
+#else
+# if defined(_WIN32) || defined(__VC32__) /* Win32 */
+# if defined (OPENVG_DLL_EXPORTS)
+# define VGU_API_CALL __declspec(dllexport)
+# else
+# define VGU_API_CALL __declspec(dllimport)
+# endif
+# else
+# define VGU_API_CALL extern
+# endif /* defined(_WIN32) ||... */
+#endif /* defined OPENVG_STATIC_LIBRARY */
+#endif /* ifndef VGU_API_CALL */
+
+
+#ifndef VG_API_ENTRY
+#define VG_API_ENTRY
+#endif
+
+#ifndef VG_API_EXIT
+#define VG_API_EXIT
+#endif
+
+#ifndef VGU_API_ENTRY
+#define VGU_API_ENTRY
+#endif
+
+#ifndef VGU_API_EXIT
+#define VGU_API_EXIT
+#endif
+
+typedef float VGfloat;
+typedef signed char VGbyte;
+typedef unsigned char VGubyte;
+typedef signed short VGshort;
+typedef signed int VGint;
+typedef unsigned int VGuint;
+typedef unsigned int VGbitfield;
+
+#ifndef VG_VGEXT_PROTOTYPES
+#define VG_VGEXT_PROTOTYPES
+#endif
+
+#ifdef __cplusplus
+} /* extern "C" */
+#endif
+
+#endif /* _VGPLATFORM_H */
diff --git a/include/VG/vgu.h b/include/VG/vgu.h new file mode 100644 index 0000000000..2799684e5e --- /dev/null +++ b/include/VG/vgu.h @@ -0,0 +1,130 @@ +/* $Revision: 6810 $ on $Date:: 2008-10-29 10:31:37 -0400 #$ */
+
+/*------------------------------------------------------------------------
+ *
+ * VGU 1.0.1 Reference Implementation
+ * -------------------------------------
+ *
+ * Copyright (c) 2008 The Khronos Group Inc.
+ *
+ * Permission is hereby granted, free of charge, to any person obtaining a
+ * copy of this software and /or associated documentation files
+ * (the "Materials "), to deal in the Materials without restriction,
+ * including without limitation the rights to use, copy, modify, merge,
+ * publish, distribute, sublicense, and/or sell copies of the Materials,
+ * and to permit persons to whom the Materials are furnished to do so,
+ * subject to the following conditions:
+ *
+ * The above copyright notice and this permission notice shall be included
+ * in all copies or substantial portions of the Materials.
+ *
+ * THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+ * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+ * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+ * IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM,
+ * DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR
+ * OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE MATERIALS OR
+ * THE USE OR OTHER DEALINGS IN THE MATERIALS.
+ *
+ *//**
+ * \file
+ * \brief VGU 1.0.1 API.
+ *//*-------------------------------------------------------------------*/
+
+#ifndef _VGU_H
+#define _VGU_H
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#include <VG/openvg.h>
+
+#define VGU_VERSION_1_0 1
+
+#ifndef VGU_API_CALL
+# error VGU_API_CALL must be defined
+#endif
+
+#ifndef VGU_API_ENTRY
+# error VGU_API_ENTRY must be defined
+#endif
+
+#ifndef VGU_API_EXIT
+# error VGU_API_EXIT must be defined
+#endif
+
+
+typedef enum {
+ VGU_NO_ERROR = 0,
+ VGU_BAD_HANDLE_ERROR = 0xF000,
+ VGU_ILLEGAL_ARGUMENT_ERROR = 0xF001,
+ VGU_OUT_OF_MEMORY_ERROR = 0xF002,
+ VGU_PATH_CAPABILITY_ERROR = 0xF003,
+ VGU_BAD_WARP_ERROR = 0xF004,
+
+ VGU_ERROR_CODE_FORCE_SIZE = VG_MAX_ENUM
+} VGUErrorCode;
+
+typedef enum {
+ VGU_ARC_OPEN = 0xF100,
+ VGU_ARC_CHORD = 0xF101,
+ VGU_ARC_PIE = 0xF102,
+
+ VGU_ARC_TYPE_FORCE_SIZE = VG_MAX_ENUM
+} VGUArcType;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguLine(VGPath path,
+ VGfloat x0, VGfloat y0,
+ VGfloat x1, VGfloat y1) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguPolygon(VGPath path,
+ const VGfloat * points, VGint count,
+ VGboolean closed) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRect(VGPath path,
+ VGfloat x, VGfloat y,
+ VGfloat width, VGfloat height) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguRoundRect(VGPath path,
+ VGfloat x, VGfloat y,
+ VGfloat width, VGfloat height,
+ VGfloat arcWidth, VGfloat arcHeight) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguEllipse(VGPath path,
+ VGfloat cx, VGfloat cy,
+ VGfloat width, VGfloat height) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguArc(VGPath path,
+ VGfloat x, VGfloat y,
+ VGfloat width, VGfloat height,
+ VGfloat startAngle, VGfloat angleExtent,
+ VGUArcType arcType) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToSquare(VGfloat sx0, VGfloat sy0,
+ VGfloat sx1, VGfloat sy1,
+ VGfloat sx2, VGfloat sy2,
+ VGfloat sx3, VGfloat sy3,
+ VGfloat * matrix) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpSquareToQuad(VGfloat dx0, VGfloat dy0,
+ VGfloat dx1, VGfloat dy1,
+ VGfloat dx2, VGfloat dy2,
+ VGfloat dx3, VGfloat dy3,
+ VGfloat * matrix) VGU_API_EXIT;
+
+VGU_API_CALL VGUErrorCode VGU_API_ENTRY vguComputeWarpQuadToQuad(VGfloat dx0, VGfloat dy0,
+ VGfloat dx1, VGfloat dy1,
+ VGfloat dx2, VGfloat dy2,
+ VGfloat dx3, VGfloat dy3,
+ VGfloat sx0, VGfloat sy0,
+ VGfloat sx1, VGfloat sy1,
+ VGfloat sx2, VGfloat sy2,
+ VGfloat sx3, VGfloat sy3,
+ VGfloat * matrix) VGU_API_EXIT;
+
+#ifdef __cplusplus
+} /* extern "C" */
+#endif
+
+#endif /* #ifndef _VGU_H */
diff --git a/progs/openvg/demos/Makefile b/progs/openvg/demos/Makefile new file mode 100644 index 0000000000..7ecb987f9d --- /dev/null +++ b/progs/openvg/demos/Makefile @@ -0,0 +1,40 @@ +# progs/vg/Makefile + +TOP = ../../.. +include $(TOP)/configs/current + +VG_LIBS=-lm -pthread -lEGL -lOpenVG +INCLUDE_DIRS = -I$(TOP)/include + +PROGRAMS = \ + gears \ + lion + +.c.o: + $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@ + + + +default: $(PROGRAMS) + + +gears: gears.o + $(CC) $(CFLAGS) gears.o -L$(TOP)/$(LIB_DIR) $(VG_LIBS) -o $@ + +gears.o: gears.c $(HEADERS) + $(CC) -c $(CFLAGS) -I$(TOP)/include gears.c + + +lion: lion.o lion-render.o + $(CC) $(CFLAGS) lion.o lion-render.o -L$(TOP)/$(LIB_DIR) $(VG_LIBS) -o $@ + +lion.o: lion.c lion-render.h $(HEADERS) + $(CC) -c $(CFLAGS) -I$(TOP)/include lion.c +lion-render.o: lion-render.c lion-render.h $(HEADERS) + $(CC) -c $(CFLAGS) -I$(TOP)/include lion-render.c + + +clean: + rm -f *.o *~ + rm -f *.so + rm -f $(PROGRAMS) diff --git a/progs/openvg/demos/gears.c b/progs/openvg/demos/gears.c new file mode 100644 index 0000000000..7dcb3954a8 --- /dev/null +++ b/progs/openvg/demos/gears.c @@ -0,0 +1,394 @@ +#include <assert.h> +#include <math.h> +#include <stdlib.h> +#include <stdio.h> +#include <string.h> +#include <X11/Xlib.h> +#include <X11/Xutil.h> +#include <X11/keysym.h> +#include <VG/openvg.h> +#include <GLES/egl.h> + +static VGint width, height; +static VGPath gear1; +static VGPath gear2; +static VGPath gear3; + +static VGPaint fill; +const VGfloat color[4] = {0.5, 0.5, 0.5, 1.0}; + +static VGfloat gear1_angle = 35; +static VGfloat gear2_angle = 24; +static VGfloat gear3_angle = 33.5; + +static void moveTo(VGPath path, VGfloat x, VGfloat y) +{ + static VGubyte moveTo = VG_MOVE_TO | VG_ABSOLUTE; + VGfloat pathData[2]; + pathData[0] = x; pathData[1] = y; + vgAppendPathData(path, 1, &moveTo, pathData); +} + +static void lineTo(VGPath path, VGfloat x, VGfloat y) +{ + static VGubyte lineTo = VG_LINE_TO | VG_ABSOLUTE; + VGfloat pathData[2]; + pathData[0] = x; pathData[1] = y; + vgAppendPathData(path, 1, &lineTo, pathData); +} + +static void closeSubpath(VGPath path) +{ + static VGubyte close = VG_CLOSE_PATH | VG_ABSOLUTE; + VGfloat pathData[2]; + vgAppendPathData(path, 1, &close, pathData); +} + +static void cubicTo(VGPath path, VGfloat x1, VGfloat y1, VGfloat x2, VGfloat y2, + VGfloat midx, VGfloat midy) +{ + static VGubyte cubic = VG_CUBIC_TO | VG_ABSOLUTE; + VGfloat pathData[6]; + pathData[0] = x1; + pathData[1] = y1; + pathData[2] = x2; + pathData[3] = y2; + pathData[4] = midx; + pathData[5] = midy; + vgAppendPathData(path, 1, &cubic, pathData); +} + +static VGPath gearsPath(double inner_radius, double outer_radius, + int teeth, double tooth_depth) +{ + VGPath path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1.0f, 0.0f, + 0, 0, (unsigned int)VG_PATH_CAPABILITY_ALL); + + int i; + double r0, r1, r2; + double angle, da; + + r0 = inner_radius; + r1 = outer_radius - tooth_depth / 2.0; + r2 = outer_radius + tooth_depth / 2.0; + + da = 2.0 * M_PI / (VGfloat) teeth / 4.0; + + angle = 0.0; + moveTo(path, r1 * cos(angle + 3 * da), r1 * sin(angle + 3 * da)); + + for (i = 1; i <= teeth; i++) { + angle = i * 2.0 * M_PI / (VGfloat)teeth; + + lineTo(path, r1 * cos(angle), r1 * sin(angle)); + lineTo(path, r2 * cos(angle + da), r2 * sin(angle + da)); + lineTo(path, r2 * cos(angle + 2 * da), r2 * sin(angle + 2 * da)); + + if (i < teeth) + lineTo(path, r1 * cos(angle + 3 * da), + r1 * sin(angle + 3 * da)); + } + + closeSubpath(path); + + moveTo(path, r0 * cos(angle + 3 * da), r0 * sin(angle + 3 * da)); + + for (i = 1; i <= teeth; i++) { + angle = i * 2.0 * M_PI / (VGfloat) teeth; + + lineTo(path, r0 * cos(angle), r0 * sin(angle)); + } + + closeSubpath(path); + return path; +} + +static void +draw(void) +{ + vgClear(0, 0, width, height); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + + vgLoadIdentity(); + vgLoadIdentity(); + vgTranslate(170, 330); + vgRotate(gear1_angle); + vgDrawPath(gear1, VG_FILL_PATH); + + vgLoadIdentity(); + vgTranslate(369, 330); + vgRotate(gear2_angle); + vgDrawPath(gear2, VG_FILL_PATH); + + vgLoadIdentity(); + vgTranslate(170, 116); + vgRotate(gear3_angle); + vgDrawPath(gear3, VG_FILL_PATH); + + gear1_angle += 1; + gear2_angle -= (20.0 / 12.0); + gear3_angle -= (20.0 / 14.0); +} + + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + width = w; + height = h; +} + + +static void +init(void) +{ + float clear_color[4] = {1.0, 1.0, 1.0, 1.0}; + vgSetfv(VG_CLEAR_COLOR, 4, clear_color); + + gear1 = gearsPath(30.0, 120.0, 20, 20.0); + gear2 = gearsPath(15.0, 75.0, 12, 20.0); + gear3 = gearsPath(20.0, 90.0, 14, 20.0); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); +} + + +/* + * Create an RGB, double-buffered X window. + * Return the window and context handles. + */ +static void +make_x_window(Display *x_dpy, EGLDisplay egl_dpy, + const char *name, + int x, int y, int width, int height, + Window *winRet, + EGLContext *ctxRet, + EGLSurface *surfRet) +{ + static const EGLint attribs[] = { + EGL_RED_SIZE, 1, + EGL_GREEN_SIZE, 1, + EGL_BLUE_SIZE, 1, + EGL_NONE + }; + + int scrnum; + XSetWindowAttributes attr; + unsigned long mask; + Window root; + Window win; + XVisualInfo *visInfo, visTemplate; + int num_visuals; + EGLContext ctx; + EGLConfig config; + EGLint num_configs; + EGLint vid; + + scrnum = DefaultScreen( x_dpy ); + root = RootWindow( x_dpy, scrnum ); + + if (!eglChooseConfig( egl_dpy, attribs, &config, 1, &num_configs)) { + printf("Error: couldn't get an EGL visual config\n"); + exit(1); + } + + assert(config); + assert(num_configs > 0); + + if (!eglGetConfigAttrib(egl_dpy, config, EGL_NATIVE_VISUAL_ID, &vid)) { + printf("Error: eglGetConfigAttrib() failed\n"); + exit(1); + } + + /* The X window visual must match the EGL config */ + visTemplate.visualid = vid; + visInfo = XGetVisualInfo(x_dpy, VisualIDMask, &visTemplate, &num_visuals); + if (!visInfo) { + printf("Error: couldn't get X visual\n"); + exit(1); + } + + /* window attributes */ + attr.background_pixel = 0; + attr.border_pixel = 0; + attr.colormap = XCreateColormap( x_dpy, root, visInfo->visual, AllocNone); + attr.event_mask = StructureNotifyMask | ExposureMask | KeyPressMask; + mask = CWBackPixel | CWBorderPixel | CWColormap | CWEventMask; + + win = XCreateWindow( x_dpy, root, 0, 0, width, height, + 0, visInfo->depth, InputOutput, + visInfo->visual, mask, &attr ); + + /* set hints and properties */ + { + XSizeHints sizehints; + sizehints.x = x; + sizehints.y = y; + sizehints.width = width; + sizehints.height = height; + sizehints.flags = USSize | USPosition; + XSetNormalHints(x_dpy, win, &sizehints); + XSetStandardProperties(x_dpy, win, name, name, + None, (char **)NULL, 0, &sizehints); + } + + eglBindAPI(EGL_OPENVG_API); + + ctx = eglCreateContext(egl_dpy, config, EGL_NO_CONTEXT, NULL ); + if (!ctx) { + printf("Error: eglCreateContext failed\n"); + exit(1); + } + + *surfRet = eglCreateWindowSurface(egl_dpy, config, win, NULL); + + if (!*surfRet) { + printf("Error: eglCreateWindowSurface failed\n"); + exit(1); + } + + XFree(visInfo); + + *winRet = win; + *ctxRet = ctx; +} + + +static void +event_loop(Display *dpy, Window win, + EGLDisplay egl_dpy, EGLSurface egl_surf) +{ + while (1) { + XEvent event; + + while (XPending(dpy) > 0) { + XNextEvent(dpy, &event); + + switch (event.type) { + case Expose: + break; + case ConfigureNotify: + reshape(event.xconfigure.width, event.xconfigure.height); + break; + case KeyPress: + { + char buffer[10]; + int r, code; + code = XLookupKeysym(&event.xkey, 0); + r = XLookupString(&event.xkey, buffer, sizeof(buffer), + NULL, NULL); + if (buffer[0] == 27) { + /* escape */ + return; + } + } + break; + default: + ; /*no-op*/ + } + } + + draw(); + eglSwapBuffers(egl_dpy, egl_surf); + } +} + + +static void +usage(void) +{ + printf("Usage:\n"); + printf(" -display <displayname> set the display to run on\n"); + printf(" -info display OpenGL renderer info\n"); +} + +int +main(int argc, char *argv[]) +{ + const int winWidth = 500, winHeight = 500; + Display *x_dpy; + Window win; + EGLSurface egl_surf; + EGLContext egl_ctx; + EGLDisplay egl_dpy; + char *dpyName = NULL; + GLboolean printInfo = GL_FALSE; + EGLint egl_major, egl_minor; + int i; + const char *s; + + for (i = 1; i < argc; i++) { + if (strcmp(argv[i], "-display") == 0) { + dpyName = argv[i+1]; + i++; + } + else if (strcmp(argv[i], "-info") == 0) { + printInfo = GL_TRUE; + } + else { + usage(); + return -1; + } + } + + x_dpy = XOpenDisplay(dpyName); + if (!x_dpy) { + printf("Error: couldn't open display %s\n", + dpyName ? dpyName : getenv("DISPLAY")); + return -1; + } + + egl_dpy = eglGetDisplay(x_dpy); + if (!egl_dpy) { + printf("Error: eglGetDisplay() failed\n"); + return -1; + } + + if (!eglInitialize(egl_dpy, &egl_major, &egl_minor)) { + printf("Error: eglInitialize() failed\n"); + return -1; + } + + s = eglQueryString(egl_dpy, EGL_VERSION); + printf("EGL_VERSION = %s\n", s); + + make_x_window(x_dpy, egl_dpy, + "xegl_tri", 0, 0, winWidth, winHeight, + &win, &egl_ctx, &egl_surf); + + XMapWindow(x_dpy, win); + if (!eglMakeCurrent(egl_dpy, egl_surf, egl_surf, egl_ctx)) { + printf("Error: eglMakeCurrent() failed\n"); + return -1; + } + + if (printInfo) { + printf("VG_RENDERER = %s\n", (char *) vgGetString(VG_RENDERER)); + printf("VG_VERSION = %s\n", (char *) vgGetString(VG_VERSION)); + printf("VG_VENDOR = %s\n", (char *) vgGetString(VG_VENDOR)); + } + + init(); + + /* Set initial projection/viewing transformation. + * We can't be sure we'll get a ConfigureNotify event when the window + * first appears. + */ + reshape(winWidth, winHeight); + + event_loop(x_dpy, win, egl_dpy, egl_surf); + + eglDestroyContext(egl_dpy, egl_ctx); + eglDestroySurface(egl_dpy, egl_surf); + eglTerminate(egl_dpy); + + + XDestroyWindow(x_dpy, win); + XCloseDisplay(x_dpy); + + return 0; +} diff --git a/progs/openvg/demos/lion-render.c b/progs/openvg/demos/lion-render.c new file mode 100644 index 0000000000..f3f151f552 --- /dev/null +++ b/progs/openvg/demos/lion-render.c @@ -0,0 +1,1573 @@ +#include "lion-render.h" + +#include <stdlib.h> +#include <stdio.h> + +#define ELEMENTS(x) (sizeof(x)/sizeof((x)[0])) + +static void init(struct lion *l, int i, VGint hexColor, const VGfloat *coords, int elems) +{ + static VGubyte cmds[128]; + VGfloat color[4]; + VGint j; + + color[0] = ((hexColor >> 16) & 0xff) / 255.f; + color[1] = ((hexColor >> 8) & 0xff) / 255.f; + color[2] = ((hexColor >> 0) & 0xff) / 255.f; + color[3] = 1.0; + + l->paths[i] = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1.0f, 0.0f, + 0, 0, (unsigned int)VG_PATH_CAPABILITY_ALL); + l->fills[i] = vgCreatePaint(); + vgSetParameterfv(l->fills[i], VG_PAINT_COLOR, 4, color); + + cmds[0] = VG_MOVE_TO_ABS; + for (j = 1; j < elems; ++j) { + cmds[j] = VG_LINE_TO_ABS; + } + + vgAppendPathData(l->paths[i], elems, cmds, coords); +} + +static void poly0(struct lion *l) +{ + VGfloat color = 0xf2cc99; + static const VGfloat coords[] = {69,18, 82,8, 99,3, 118,5, 135,12, 149,21, 156,13, 165,9, 177,13, 183,28, + 180,50, 164,91, 155,107, 154,114, 151,121, 141,127, 139,136, 155,206, 157,251, 126,342, + 133,357, 128,376, 83,376, 75,368, 67,350, 61,350, 53,369, 4,369, 2,361, 5,354, + 12,342, 16,321, 4,257, 4,244, 7,218, 9,179, 26,127, 43,93, 32,77, 30,70, + 24,67, 16,49, 17,35, 18,23, 30,12, 40,7, 53,7, 62,12 + }; + + init(l, 0, color, coords, ELEMENTS(coords)/2); +} + +static void poly1(struct lion *l) +{ + VGfloat color = 0xe5b27f; + static const VGfloat coords[] = {142,79, 136,74, 138,82, 133,78, 133,84, 127,78, 128,85, + 124,80, 125,87, 119,82, 119,90, 125,99, 125,96, 128,100, 128,94, + 131,98, 132,93, 135,97, 136,93, 138,97, 139,94, 141,98, 143,94, + 144,85 + }; + + init(l, 1, color, coords, ELEMENTS(coords)/2); +} + +static void poly2(struct lion *l) +{ + VGfloat color = 0xeb8080; + static const VGfloat coords[] = {127,101, 132,100, 137,99, 144,101, 143,105, 135,110 + }; + + init(l, 2, color, coords, ELEMENTS(coords)/2); +} + +static void poly3(struct lion *l) +{ + VGfloat color = 0xf2cc99; + static const VGfloat coords[] = {178,229, 157,248, 139,296, 126,349, 137,356, + 158,357, 183,342, 212,332, 235,288, 235,261, + 228,252, 212,250, 188,251 + }; + + init(l, 3, color, coords, ELEMENTS(coords)/2); +} + +static void poly4(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {56,229, 48,241, 48,250, 57,281, 63,325, 71,338, + 81,315, 76,321, 79,311, 83,301, 75,308, 80,298, + 73,303, 76,296, 71,298, 74,292, 69,293, 74,284, + 78,278, 71,278, 74,274, 68,273, 70,268, 66,267, + 68,261, 60,266, 62,259, 65,253, 57,258, 59,251, + 55,254, 55,248, 60,237, 54,240, 58,234, 54,236 + }; + + init(l, 4, color, coords, ELEMENTS(coords)/2); +} + +static void poly5(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {74,363, 79,368, 81,368, 85,362, 89,363, 92,370, 96,373, + 101,372, 108,361, 110,371, 113,373, 116,371, 120,358, 122,363, + 123,371, 126,371, 129,367, 132,357, 135,361, 130,376, 127,377, + 94,378, 84,376, 76,371 + }; + + init(l, 5, color, coords, ELEMENTS(coords)/2); +} + +static void poly6(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {212,250, 219,251, 228,258, 236,270, 235,287, 225,304, + 205,332, 177,343, 171,352, 158,357, 166,352, 168,346, + 168,339, 165,333, 155,327, 155,323, 161,320, 165,316, + 169,316, 167,312, 171,313, 168,308, 173,309, 170,306, + 177,306, 175,308, 177,311, 174,311, 176,316, 171,315, + 174,319, 168,320, 168,323, 175,327, 179,332, 183,326, + 184,332, 189,323, 190,328, 194,320, 194,325, 199,316, + 201,320, 204,313, 206,316, 208,310, 211,305, 219,298, + 226,288, 229,279, 228,266, 224,259, 217,253 + }; + + init(l, 6, color, coords, ELEMENTS(coords)/2); +} + +static void poly7(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {151,205, 151,238, 149,252, 141,268, 128,282, 121,301, + 130,300, 126,313, 118,324, 116,337, 120,346, 133,352, + 133,340, 137,333, 145,329, 156,327, 153,319, 153,291, + 157,271, 170,259, 178,277, 193,250, 174,216 + }; + + init(l, 7, color, coords, ELEMENTS(coords)/2); +} + +static void poly8(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {78,127, 90,142, 95,155, 108,164, 125,167, 139,175, + 150,206, 152,191, 141,140, 121,148, 100,136 + }; + + init(l, 8, color, coords, ELEMENTS(coords)/2); +} + +static void poly9(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {21,58, 35,63, 38,68, 32,69, 42,74, 40,79, 47,80, 54,83, + 45,94, 34,81, 32,73, 24,66 + }; + + init(l, 9, color, coords, ELEMENTS(coords)/2); +} + +static void poly10(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {71,34, 67,34, 66,27, 59,24, 54,17, 48,17, 39,22, + 30,26, 28,31, 31,39, 38,46, 29,45, 36,54, 41,61, + 41,70, 50,69, 54,71, 55,58, 67,52, 76,43, 76,39, + 68,44 + }; + + init(l, 10, color, coords, ELEMENTS(coords)/2); +} + +static void poly11(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {139,74, 141,83, 143,89, 144,104, 148,104, 155,106, + 154,86, 157,77, 155,72, 150,77, 144,77 + }; + + init(l, 11, color, coords, ELEMENTS(coords)/2); +} + +static void poly12(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {105,44, 102,53, 108,58, 111,62, 112,55 + }; + + init(l, 12, color, coords, ELEMENTS(coords)/2); +} + +static void poly13(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {141,48, 141,54, 144,58, 139,62, 137,66, 136,59, 137,52 + }; + + init(l, 13, color, coords, ELEMENTS(coords)/2); +} + +static void poly14(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {98,135, 104,130, 105,134, 108,132, 108,135, 112,134, + 113,137, 116,136, 116,139, 119,139, 124,141, 128,140, + 133,138, 140,133, 139,140, 126,146, 104,144 + }; + + init(l, 14, color, coords, ELEMENTS(coords)/2); +} + +static void poly15(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {97,116, 103,119, 103,116, 111,118, 116,117, 122,114, + 127,107, 135,111, 142,107, 141,114, 145,118, 149,121, + 145,125, 140,124, 127,121, 113,125, 100,124 + }; + + init(l, 15, color, coords, ELEMENTS(coords)/2); +} + +static void poly16(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {147,33, 152,35, 157,34, 153,31, 160,31, 156,28, 161,28, + 159,24, 163,25, 163,21, 165,22, 170,23, 167,17, 172,21, + 174,18, 175,23, 176,22, 177,28, 177,33, 174,37, 176,39, + 174,44, 171,49, 168,53, 164,57, 159,68, 156,70, 154,60, + 150,51, 146,43, 144,35 + }; + + init(l, 16, color, coords, ELEMENTS(coords)/2); +} + +static void poly17(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {85,72, 89,74, 93,75, 100,76, 105,75, 102,79, 94,79, 88,76 + }; + + init(l, 17, color, coords, ELEMENTS(coords)/2); +} + +static void poly18(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {86,214, 79,221, 76,232, 82,225, 78,239, 82,234, 78,245, + 81,243, 79,255, 84,250, 84,267, 87,254, 90,271, 90,257, + 95,271, 93,256, 95,249, 92,252, 93,243, 89,253, 89,241, + 86,250, 87,236, 83,245, 87,231, 82,231, 90,219, 84,221 + }; + + init(l, 18, color, coords, ELEMENTS(coords)/2); +} + +static void poly19(struct lion *l) +{ + VGfloat color = 0xffcc7f; + static const VGfloat coords[] = {93,68, 96,72, 100,73, 106,72, 108,66, 105,63, 100,62 + }; + + init(l, 19, color, coords, ELEMENTS(coords)/2); +} + +static void poly20(struct lion *l) +{ + VGfloat color = 0xffcc7f; + static const VGfloat coords[] = {144,64, 142,68, 142,73, 146,74, 150,73, 154,64, 149,62 + }; + + init(l, 20, color, coords, ELEMENTS(coords)/2); +} + +static void poly21(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {57,91, 42,111, 52,105, 41,117, 53,112, 46,120, 53,116, + 50,124, 57,119, 55,127, 61,122, 60,130, 67,126, 66,134, + 71,129, 72,136, 77,130, 76,137, 80,133, 82,138, 86,135, + 96,135, 94,129, 86,124, 83,117, 77,123, 79,117, 73,120, + 75,112, 68,116, 71,111, 65,114, 69,107, 63,110, 68,102, + 61,107, 66,98, 61,103, 63,97, 57,99 + }; + + init(l, 21, color, coords, ELEMENTS(coords)/2); +} + +static void poly22(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {83,79, 76,79, 67,82, 75,83, 65,88, 76,87, 65,92, 76,91, + 68,96, 77,95, 70,99, 80,98, 72,104, 80,102, 76,108, 85,103, + 92,101, 87,98, 93,96, 86,94, 91,93, 85,91, 93,89, 99,89, 105,93, + 107,85, 102,82, 92,80 + }; + + init(l, 22, color, coords, ELEMENTS(coords)/2); +} + +static void poly23(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {109,77, 111,83, 109,89, 113,94, 117,90, 117,81, 114,78 + }; + + init(l, 23, color, coords, ELEMENTS(coords)/2); +} + +static void poly24(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {122,128, 127,126, 134,127, 136,129, 134,130, 130,128, 124,129 + }; + + init(l, 24, color, coords, ELEMENTS(coords)/2); +} + +static void poly25(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {78,27, 82,32, 80,33, 82,36, 78,37, 82,40, 78,42, 81,46, 76,47, + 78,49, 74,50, 82,52, 87,50, 83,48, 91,46, 86,45, 91,42, 88,40, + 92,37, 86,34, 90,31, 86,29, 89,26 + }; + + init(l, 25, color, coords, ELEMENTS(coords)/2); +} + +static void poly26(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {82,17, 92,20, 79,21, 90,25, 81,25, 94,28, 93,26, 101,30, + 101,26, 107,33, 108,28, 111,40, 113,34, 115,45, 117,39, + 119,54, 121,46, 124,58, 126,47, 129,59, 130,49, 134,58, + 133,44, 137,48, 133,37, 137,40, 133,32, 126,20, 135,26, + 132,19, 138,23, 135,17, 142,18, 132,11, 116,6, 94,6, 78,11, + 92,12, 80,14, 90,16 + }; + + init(l, 26, color, coords, ELEMENTS(coords)/2); +} + +static void poly27(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {142,234, 132,227, 124,223, 115,220, 110,225, 118,224, 127,229, + 135,236, 122,234, 115,237, 113,242, 121,238, 139,243, 121,245, + 111,254, 95,254, 102,244, 104,235, 110,229, 100,231, 104,224, + 113,216, 122,215, 132,217, 141,224, 145,230, 149,240 + }; + + init(l, 27, color, coords, ELEMENTS(coords)/2); +} + +static void poly28(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {115,252, 125,248, 137,249, 143,258, 134,255, 125,254 + }; + + init(l, 28, color, coords, ELEMENTS(coords)/2); +} + +static void poly29(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {114,212, 130,213, 140,219, 147,225, 144,214, 137,209, 128,207 + }; + + init(l, 29, color, coords, ELEMENTS(coords)/2); +} + +static void poly30(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {102,263, 108,258, 117,257, 131,258, 116,260, 109,265 + }; + + init(l, 30, color, coords, ELEMENTS(coords)/2); +} + +static void poly31(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {51,241, 35,224, 40,238, 23,224, 31,242, 19,239, 28,247, 17,246, + 25,250, 37,254, 39,263, 44,271, 47,294, 48,317, 51,328, 60,351, + 60,323, 53,262, 47,246 + }; + + init(l, 31, color, coords, ELEMENTS(coords)/2); +} + +static void poly32(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {2,364, 9,367, 14,366, 18,355, 20,364, 26,366, 31,357, 35,364, + 39,364, 42,357, 47,363, 53,360, 59,357, 54,369, 7,373 + }; + + init(l, 32, color, coords, ELEMENTS(coords)/2); +} + +static void poly33(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {7,349, 19,345, 25,339, 18,341, 23,333, 28,326, 23,326, 27,320, + 23,316, 25,311, 20,298, 15,277, 12,264, 9,249, 10,223, 3,248, + 5,261, 15,307, 17,326, 11,343 + }; + + init(l, 33, color, coords, ELEMENTS(coords)/2); +} + +static void poly34(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {11,226, 15,231, 25,236, 18,227 + }; + + init(l, 34, color, coords, ELEMENTS(coords)/2); +} + +static void poly35(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {13,214, 19,217, 32,227, 23,214, 16,208, 15,190, 24,148, + 31,121, 24,137, 14,170, 8,189 + }; + + init(l, 35, color, coords, ELEMENTS(coords)/2); +} + +static void poly36(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {202,254, 195,258, 199,260, 193,263, 197,263, 190,268, + 196,268, 191,273, 188,282, 200,272, 194,272, 201,266, + 197,265, 204,262, 200,258, 204,256 + }; + + init(l, 36, color, coords, ELEMENTS(coords)/2); +} + +static void poly37(struct lion *l) +{ + VGfloat color = 0x845433; + static const VGfloat coords[] = {151,213, 165,212, 179,225, 189,246, 187,262, 179,275, + 176,263, 177,247, 171,233, 163,230, 165,251, 157,264, + 146,298, 145,321, 133,326, 143,285, 154,260, 153,240 + }; + + init(l, 37, color, coords, ELEMENTS(coords)/2); +} + +static void poly38(struct lion *l) +{ + VGfloat color = 0x845433; + static const VGfloat coords[] = {91,132, 95,145, 97,154, 104,148, 107,155, 109,150, 111,158, + 115,152, 118,159, 120,153, 125,161, 126,155, 133,164, 132,154, + 137,163, 137,152, 142,163, 147,186, 152,192, 148,167, 141,143, + 124,145, 105,143 + }; + + init(l, 38, color, coords, ELEMENTS(coords)/2); +} + +static void poly39(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {31,57, 23,52, 26,51, 20,44, 23,42, 21,36, 22,29, 25,23, + 24,32, 30,43, 26,41, 30,50, 26,48 + }; + + init(l, 39, color, coords, ELEMENTS(coords)/2); +} + +static void poly40(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {147,21, 149,28, 155,21, 161,16, 167,14, 175,15, 173,11, 161,9 + }; + + init(l, 40, color, coords, ELEMENTS(coords)/2); +} + +static void poly41(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {181,39, 175,51, 169,57, 171,65, 165,68, 165,75, 160,76, + 162,91, 171,71, 180,51 + }; + + init(l, 41, color, coords, ELEMENTS(coords)/2); +} + +static void poly42(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {132,346, 139,348, 141,346, 142,341, 147,342, 143,355, 133,350 + }; + + init(l, 42, color, coords, ELEMENTS(coords)/2); +} + +static void poly43(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {146,355, 151,352, 155,348, 157,343, 160,349, 151,356, 147,357 + }; + + init(l, 43, color, coords, ELEMENTS(coords)/2); +} + +static void poly44(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {99,266, 100,281, 94,305, 86,322, 78,332, 72,346, 73,331, 91,291 + }; + + init(l, 44, color, coords, ELEMENTS(coords)/2); +} + +static void poly45(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {20,347, 32,342, 45,340, 54,345, 45,350, 42,353, 38,350, + 31,353, 29,356, 23,350, 19,353, 15,349 + }; + + init(l, 45, color, coords, ELEMENTS(coords)/2); +} + +static void poly46(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {78,344, 86,344, 92,349, 88,358, 84,352 + }; + + init(l, 46, color, coords, ELEMENTS(coords)/2); +} + +static void poly47(struct lion *l) +{ + VGfloat color = 0x9c826b; + static const VGfloat coords[] = {93,347, 104,344, 117,345, 124,354, 121,357, 116,351, + 112,351, 108,355, 102,351 + }; + + init(l, 47, color, coords, ELEMENTS(coords)/2); +} + +static void poly48(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {105,12, 111,18, 113,24, 113,29, 119,34, 116,23, 112,16 + }; + + init(l, 48, color, coords, ELEMENTS(coords)/2); +} + +static void poly49(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {122,27, 125,34, 127,43, 128,34, 125,29 + }; + + init(l, 49, color, coords, ELEMENTS(coords)/2); +} + +static void poly50(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {115,13, 122,19, 122,15, 113,10 + }; + + init(l, 50, color, coords, ELEMENTS(coords)/2); +} + +static void poly51(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {116,172, 107,182, 98,193, 98,183, 90,199, 89,189, 84,207, + 88,206, 87,215, 95,206, 93,219, 91,230, 98,216, 97,226, + 104,214, 112,209, 104,208, 113,202, 126,200, 139,207, 132,198, + 142,203, 134,192, 142,195, 134,187, 140,185, 130,181, 136,177, + 126,177, 125,171, 116,180 + }; + + init(l, 51, color, coords, ELEMENTS(coords)/2); +} + +static void poly52(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {74,220, 67,230, 67,221, 59,235, 63,233, 60,248, 70,232, 65,249, + 71,243, 67,256, 73,250, 69,262, 73,259, 71,267, 76,262, 72,271, + 78,270, 76,275, 82,274, 78,290, 86,279, 86,289, 92,274, 88,275, + 87,264, 82,270, 82,258, 77,257, 78,247, 73,246, 77,233, 72,236 + }; + + init(l, 52, color, coords, ELEMENTS(coords)/2); +} + +static void poly53(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {133,230, 147,242, 148,250, 145,254, 138,247, 129,246, 142,245, + 138,241, 128,237, 137,238 + }; + + init(l, 53, color, coords, ELEMENTS(coords)/2); +} + +static void poly54(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {133,261, 125,261, 116,263, 111,267, 125,265 + }; + + init(l, 54, color, coords, ELEMENTS(coords)/2); +} + +static void poly55(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {121,271, 109,273, 103,279, 99,305, 92,316, 85,327, 83,335, + 89,340, 97,341, 94,336, 101,336, 96,331, 103,330, 97,327, 108,325, + 99,322, 109,321, 100,318, 110,317, 105,314, 110,312, 107,310, 113,308, + 105,306, 114,303, 105,301, 115,298, 107,295, 115,294, 108,293, 117,291, + 109,289, 117,286, 109,286, 118,283, 112,281, 118,279, 114,278, + 119,276, 115,274 + }; + + init(l, 55, color, coords, ELEMENTS(coords)/2); +} + +static void poly56(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {79,364, 74,359, 74,353, 76,347, 80,351, 83,356, 82,360 + }; + + init(l, 56, color, coords, ELEMENTS(coords)/2); +} + +static void poly57(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {91,363, 93,356, 97,353, 103,355, 105,360, 103,366, 99,371, 94,368 + }; + + init(l, 57, color, coords, ELEMENTS(coords)/2); +} + +static void poly58(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {110,355, 114,353, 118,357, 117,363, 113,369, 111,362 + }; + + init(l, 58, color, coords, ELEMENTS(coords)/2); +} + +static void poly59(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {126,354, 123,358, 124,367, 126,369, 129,361, 129,357 + }; + + init(l, 59, color, coords, ELEMENTS(coords)/2); +} + +static void poly60(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {30,154, 24,166, 20,182, 23,194, 29,208, 37,218, 41,210, 41,223, + 46,214, 46,227, 52,216, 52,227, 61,216, 59,225, 68,213, 73,219, + 70,207, 77,212, 69,200, 77,202, 70,194, 78,197, 68,187, 76,182, + 64,182, 58,175, 58,185, 53,177, 50,186, 46,171, 44,182, 39,167, + 36,172, 36,162, 30,166 + }; + + init(l, 60, color, coords, ELEMENTS(coords)/2); +} + +static void poly61(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {44,130, 41,137, 45,136, 43,150, 48,142, 48,157, 53,150, + 52,164, 60,156, 61,169, 64,165, 66,175, 70,167, 74,176, + 77,168, 80,183, 85,172, 90,182, 93,174, 98,181, 99,173, + 104,175, 105,169, 114,168, 102,163, 95,157, 94,166, 90,154, + 87,162, 82,149, 75,159, 72,148, 68,155, 67,143, 62,148, 62,138, + 58,145, 56,133, 52,142, 52,128, 49,134, 47,125 + }; + + init(l, 61, color, coords, ELEMENTS(coords)/2); +} + +static void poly62(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {13,216, 19,219, 36,231, 22,223, 16,222, 22,227, 12,224, 13,220, 16,220 + }; + + init(l, 62, color, coords, ELEMENTS(coords)/2); +} + +static void poly63(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {10,231, 14,236, 25,239, 27,237, 19,234 + }; + + init(l, 63, color, coords, ELEMENTS(coords)/2); +} + +static void poly64(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {9,245, 14,242, 25,245, 13,245 + }; + + init(l, 64, color, coords, ELEMENTS(coords)/2); +} + +static void poly65(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {33,255, 26,253, 18,254, 25,256, 18,258, 27,260, 18,263, + 27,265, 19,267, 29,270, 21,272, 29,276, 21,278, 30,281, + 22,283, 31,287, 24,288, 32,292, 23,293, 34,298, 26,299, + 37,303, 32,305, 39,309, 33,309, 39,314, 34,314, 40,318, + 34,317, 40,321, 34,321, 41,326, 33,326, 40,330, 33,332, + 39,333, 33,337, 42,337, 54,341, 49,337, 52,335, 47,330, + 50,330, 45,325, 49,325, 45,321, 48,321, 45,316, 46,306, + 45,286, 43,274, 36,261 + }; + + init(l, 65, color, coords, ELEMENTS(coords)/2); +} + +static void poly66(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {7,358, 9,351, 14,351, 17,359, 11,364 + }; + + init(l, 66, color, coords, ELEMENTS(coords)/2); +} + +static void poly67(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {44,354, 49,351, 52,355, 49,361 + }; + + init(l, 67, color, coords, ELEMENTS(coords)/2); +} + +static void poly68(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {32,357, 37,353, 40,358, 36,361 + }; + + init(l, 68, color, coords, ELEMENTS(coords)/2); +} + +static void poly69(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {139,334, 145,330, 154,330, 158,334, 154,341, 152,348, + 145,350, 149,340, 147,336, 141,339, 139,345, 136,342, + 136,339 + }; + + init(l, 69, color, coords, ELEMENTS(coords)/2); +} + +static void poly70(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {208,259, 215,259, 212,255, 220,259, 224,263, 225,274, 224,283, + 220,292, 208,300, 206,308, 203,304, 199,315, 197,309, 195,318, + 193,313, 190,322, 190,316, 185,325, 182,318, 180,325, 172,321, + 178,320, 176,313, 186,312, 180,307, 188,307, 184,303, 191,302, + 186,299, 195,294, 187,290, 197,288, 192,286, 201,283, 194,280, + 203,277, 198,275, 207,271, 200,269, 209,265, 204,265, 212,262 + }; + + init(l, 70, color, coords, ELEMENTS(coords)/2); +} + +static void poly71(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {106,126, 106,131, 109,132, 111,134, 115,132, 115,135, 119,133, 118,137, + 123,137, 128,137, 133,134, 136,130, 136,127, 132,124, 118,128, 112,128, + 106,126, 106,126, 106,126 + }; + + init(l, 71, color, coords, ELEMENTS(coords)/2); +} + +static void poly72(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {107,114, 101,110, 98,102, 105,97, 111,98, 119,102, 121,108, 118,112, 113,115 + }; + + init(l, 72, color, coords, ELEMENTS(coords)/2); +} + +static void poly73(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {148,106, 145,110, 146,116, 150,118, 152,111, 151,107 + }; + + init(l, 73, color, coords, ELEMENTS(coords)/2); +} + +static void poly74(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {80,55, 70,52, 75,58, 63,57, 72,61, 57,61, 67,66, 57,67, 62,69, 54,71, + 61,73, 54,77, 63,78, 53,85, 60,84, 56,90, 69,84, 63,82, 75,76, 70,75, + 77,72, 72,71, 78,69, 72,66, 81,67, 78,64, 82,63, 80,60, 86,62 + }; + + init(l, 74, color, coords, ELEMENTS(coords)/2); +} + +static void poly75(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {87,56, 91,52, 96,50, 102,56, 98,56, 92,60 + }; + + init(l, 75, color, coords, ELEMENTS(coords)/2); +} + +static void poly76(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {85,68, 89,73, 98,76, 106,74, 96,73, 91,70 + }; + + init(l, 76, color, coords, ELEMENTS(coords)/2); +} + +static void poly77(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {115,57, 114,64, 111,64, 115,75, 122,81, 122,74, 126,79, + 126,74, 131,78, 130,72, 133,77, 131,68, 126,61, 119,57 + }; + + init(l, 77, color, coords, ELEMENTS(coords)/2); +} + +static void poly78(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {145,48, 143,53, 147,59, 151,59, 150,55 + }; + + init(l, 78, color, coords, ELEMENTS(coords)/2); +} + +static void poly79(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {26,22, 34,15, 43,10, 52,10, 59,16, 47,15, 32,22 + }; + + init(l, 79, color, coords, ELEMENTS(coords)/2); +} + +static void poly80(struct lion *l) +{ + VGfloat color = 0xffe5b2; + static const VGfloat coords[] = {160,19, 152,26, 149,34, 154,33, 152,30, 157,30, 155,26, 158,27, + 157,23, 161,23 + }; + + init(l, 80, color, coords, ELEMENTS(coords)/2); +} + +static void poly81(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {98,117, 105,122, 109,122, 105,117, 113,120, 121,120, 130,112, 128,108, + 123,103, 123,99, 128,101, 132,106, 135,109, 142,105, 142,101, 145,101, + 145,91, 148,101, 145,105, 136,112, 135,116, 143,124, 148,120, 150,122, + 142,128, 133,122, 121,125, 112,126, 103,125, 100,129, 96,124 + }; + + init(l, 81, color, coords, ELEMENTS(coords)/2); +} + +static void poly82(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {146,118, 152,118, 152,115, 149,115 + }; + + init(l, 82, color, coords, ELEMENTS(coords)/2); +} + +static void poly83(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {148,112, 154,111, 154,109, 149,109 + }; + + init(l, 83, color, coords, ELEMENTS(coords)/2); +} + +static void poly84(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {106,112, 108,115, 114,116, 118,114 + }; + + init(l, 84, color, coords, ELEMENTS(coords)/2); +} + +static void poly85(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {108,108, 111,110, 116,110, 119,108 + }; + + init(l, 85, color, coords, ELEMENTS(coords)/2); +} + +static void poly86(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {106,104, 109,105, 117,106, 115,104 + }; + + init(l, 86, color, coords, ELEMENTS(coords)/2); +} + +static void poly87(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {50,25, 41,26, 34,33, 39,43, 49,58, 36,51, 47,68, 55,69, 54,59, + 61,57, 74,46, 60,52, 67,42, 57,48, 61,40, 54,45, 60,36, 59,29, + 48,38, 52,30, 47,32 + }; + + init(l, 87, color, coords, ELEMENTS(coords)/2); +} + +static void poly88(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {147,34, 152,41, 155,49, 161,53, 157,47, 164,47, 158,43, 168,44, + 159,40, 164,37, 169,37, 164,33, 169,34, 165,28, 170,30, 170,25, + 173,29, 175,27, 176,32, 173,36, 175,39, 172,42, 172,46, 168,49, + 170,55, 162,57, 158,63, 155,58, 153,50, 149,46 + }; + + init(l, 88, color, coords, ELEMENTS(coords)/2); +} + +static void poly89(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {155,71, 159,80, 157,93, 157,102, 155,108, 150,101, 149,93, + 154,101, 152,91, 151,83, 155,79 + }; + + init(l, 89, color, coords, ELEMENTS(coords)/2); +} + +static void poly90(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {112,78, 115,81, 114,91, 112,87, 113,82 + }; + + init(l, 90, color, coords, ELEMENTS(coords)/2); +} + +static void poly91(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {78,28, 64,17, 58,11, 47,9, 36,10, 28,16, 21,26, 18,41, + 20,51, 23,61, 33,65, 28,68, 37,74, 36,81, 43,87, 48,90, + 43,100, 40,98, 39,90, 31,80, 30,72, 22,71, 17,61, 14,46, + 16,28, 23,17, 33,9, 45,6, 54,6, 65,12 + }; + + init(l, 91, color, coords, ELEMENTS(coords)/2); +} + +static void poly92(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {67,18, 76,9, 87,5, 101,2, 118,3, 135,8, 149,20, 149,26, + 144,19, 132,12, 121,9, 105,7, 89,8, 76,14, 70,20 + }; + + init(l, 92, color, coords, ELEMENTS(coords)/2); +} + +static void poly93(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {56,98, 48,106, 56,103, 47,112, 56,110, 52,115, 57,113, 52,121, 62,115, + 58,123, 65,119, 63,125, 69,121, 68,127, 74,125, 74,129, 79,128, 83,132, + 94,135, 93,129, 85,127, 81,122, 76,126, 75,121, 71,124, 71,117, 66,121, + 66,117, 62,117, 64,112, 60,113, 60,110, 57,111, 61,105, 57,107, 60,101, + 55,102 + }; + + init(l, 93, color, coords, ELEMENTS(coords)/2); +} + +static void poly94(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {101,132, 103,138, 106,134, 106,139, 112,136, 111,142, 115,139, + 114,143, 119,142, 125,145, 131,142, 135,138, 140,134, 140,129, + 143,135, 145,149, 150,171, 149,184, 145,165, 141,150, 136,147, + 132,151, 131,149, 126,152, 125,150, 121,152, 117,148, 111,152, + 110,148, 105,149, 104,145, 98,150, 96,138, 94,132, 94,130, 98,132 + }; + + init(l, 94, color, coords, ELEMENTS(coords)/2); +} + +static void poly95(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {41,94, 32,110, 23,132, 12,163, 6,190, 7,217, 5,236, + 3,247, 9,230, 12,211, 12,185, 18,160, 26,134, 35,110, + 43,99 + }; + + init(l, 95, color, coords, ELEMENTS(coords)/2); +} + +static void poly96(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {32,246, 41,250, 50,257, 52,267, 53,295, 53,323, 59,350, + 54,363, 51,365, 44,366, 42,360, 40,372, 54,372, 59,366, + 62,353, 71,352, 75,335, 73,330, 66,318, 68,302, 64,294, + 67,288, 63,286, 63,279, 59,275, 58,267, 56,262, 50,247, + 42,235, 44,246, 32,236, 35,244 + }; + + init(l, 96, color, coords, ELEMENTS(coords)/2); +} + +static void poly97(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {134,324, 146,320, 159,322, 173,327, 179,337, 179,349, + 172,355, 158,357, 170,350, 174,343, 170,333, 163,328, 152,326, + 134,329 + }; + + init(l, 97, color, coords, ELEMENTS(coords)/2); +} + +static void poly98(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {173,339, 183,334, 184,338, 191,329, 194,332, 199,323, 202,325, + 206,318, 209,320, 213,309, 221,303, 228,296, 232,289, 234,279, + 233,269, 230,262, 225,256, 219,253, 208,252, 198,252, 210,249, + 223,250, 232,257, 237,265, 238,277, 238,291, 232,305, 221,323, + 218,335, 212,342, 200,349, 178,348 + }; + + init(l, 98, color, coords, ELEMENTS(coords)/2); +} + +static void poly99(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {165,296, 158,301, 156,310, 156,323, 162,324, 159,318, + 162,308, 162,304 + }; + + init(l, 99, color, coords, ELEMENTS(coords)/2); +} + +static void poly100(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {99,252, 105,244, 107,234, 115,228, 121,228, 131,235, + 122,233, 113,235, 109,246, 121,239, 133,243, 121,243, + 110,251 + }; + + init(l, 100, color, coords, ELEMENTS(coords)/2); +} + +static void poly101(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {117,252, 124,247, 134,249, 136,253, 126,252 + }; + + init(l, 101, color, coords, ELEMENTS(coords)/2); +} + +static void poly102(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {117,218, 132,224, 144,233, 140,225, 132,219, 117,218, + 117,218, 117,218 + }; + + init(l, 102, color, coords, ELEMENTS(coords)/2); +} + +static void poly103(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {122,212, 134,214, 143,221, 141,213, 132,210 + }; + + init(l, 103, color, coords, ELEMENTS(coords)/2); +} + +static void poly104(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {69,352, 70,363, 76,373, 86,378, 97,379, 108,379, 120,377, + 128,378, 132,373, 135,361, 133,358, 132,366, 127,375, 121,374, + 121,362, 119,367, 117,374, 110,376, 110,362, 107,357, 106,371, + 104,375, 97,376, 90,375, 90,368, 86,362, 83,364, 86,369, 85,373, + 78,370, 73,362, 71,351 + }; + + init(l, 104, color, coords, ELEMENTS(coords)/2); +} + +static void poly105(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {100,360, 96,363, 99,369, 102,364 + }; + + init(l, 105, color, coords, ELEMENTS(coords)/2); +} + +static void poly106(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {115,360, 112,363, 114,369, 117,364 + }; + + init(l, 106, color, coords, ELEMENTS(coords)/2); +} + +static void poly107(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {127,362, 125,364, 126,369, 128,365 + }; + + init(l, 107, color, coords, ELEMENTS(coords)/2); +} + +static void poly108(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {5,255, 7,276, 11,304, 15,320, 13,334, 6,348, 2,353, 0,363, + 5,372, 12,374, 25,372, 38,372, 44,369, 42,367, 36,368, 31,369, + 30,360, 27,368, 20,370, 16,361, 15,368, 10,369, 3,366, 3,359, 6,352, + 11,348, 17,331, 19,316, 12,291, 9,274 + }; + + init(l, 108, color, coords, ELEMENTS(coords)/2); +} + +static void poly109(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {10,358, 7,362, 10,366, 11,362 + }; + + init(l, 109, color, coords, ELEMENTS(coords)/2); +} + +static void poly110(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {25,357, 22,360, 24,366, 27,360 + }; + + init(l, 110, color, coords, ELEMENTS(coords)/2); +} + +static void poly111(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {37,357, 34,361, 36,365, 38,361 + }; + + init(l, 111, color, coords, ELEMENTS(coords)/2); +} + +static void poly112(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {49,356, 46,359, 47,364, 50,360 + }; + + init(l, 112, color, coords, ELEMENTS(coords)/2); +} + +static void poly113(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {130,101, 132,102, 135,101, 139,102, 143,103, + 142,101, 137,100, 133,100 + }; + + init(l, 113, color, coords, ELEMENTS(coords)/2); +} + +static void poly114(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {106,48, 105,52, 108,56, 109,52 + }; + + init(l, 114, color, coords, ELEMENTS(coords)/2); +} + +static void poly115(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {139,52, 139,56, 140,60, 142,58, 141,56 + }; + + init(l, 115, color, coords, ELEMENTS(coords)/2); +} + +static void poly116(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {25,349, 29,351, 30,355, 33,350, 37,348, 42,351, 45,347, + 49,345, 44,343, 36,345 + }; + + init(l, 116, color, coords, ELEMENTS(coords)/2); +} + +static void poly117(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {98,347, 105,351, 107,354, 109,349, 115,349, 120,353, 118,349, + 113,346, 104,346 + }; + + init(l, 117, color, coords, ELEMENTS(coords)/2); +} + +static void poly118(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {83,348, 87,352, 87,357, 89,351, 87,348 + }; + + init(l, 118, color, coords, ELEMENTS(coords)/2); +} + +static void poly119(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {155,107, 163,107, 170,107, 186,108, 175,109, 155,109 + }; + + init(l, 119, color, coords, ELEMENTS(coords)/2); +} + +static void poly120(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {153,114, 162,113, 175,112, 192,114, 173,114, 154,115 + }; + + init(l, 120, color, coords, ELEMENTS(coords)/2); +} + +static void poly121(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {152,118, 164,120, 180,123, 197,129, 169,123, 151,120 + }; + + init(l, 121, color, coords, ELEMENTS(coords)/2); +} + +static void poly122(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {68,109, 87,106, 107,106, 106,108, 88,108 + }; + + init(l, 122, color, coords, ELEMENTS(coords)/2); +} + +static void poly123(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {105,111, 95,112, 79,114, 71,116, 85,115, 102,113 + }; + + init(l, 123, color, coords, ELEMENTS(coords)/2); +} + +static void poly124(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {108,101, 98,99, 87,99, 78,99, 93,100, 105,102 + }; + + init(l, 124, color, coords, ELEMENTS(coords)/2); +} + +static void poly125(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {85,63, 91,63, 97,60, 104,60, 108,62, 111,69, 112,75, + 110,74, 108,71, 103,73, 106,69, 105,65, 103,64, 103,67, + 102,70, 99,70, 97,66, 94,67, 97,72, 88,67, 84,66 + }; + + init(l, 125, color, coords, ELEMENTS(coords)/2); +} + +static void poly126(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {140,74, 141,66, 144,61, 150,61, 156,62, 153,70, 150,73, + 152,65, 150,65, 151,68, 149,71, 146,71, 144,66, 143,70, + 143,74 + }; + + init(l, 126, color, coords, ELEMENTS(coords)/2); +} + +static void poly127(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {146,20, 156,11, 163,9, 172,9, 178,14, 182,18, 184,32, 182,42, + 182,52, 177,58, 176,67, 171,76, 165,90, 157,105, 160,92, 164,85, + 168,78, 167,73, 173,66, 172,62, 175,59, 174,55, 177,53, 180,46, + 181,29, 179,21, 173,13, 166,11, 159,13, 153,18, 148,23 + }; + + init(l, 127, color, coords, ELEMENTS(coords)/2); +} + +static void poly128(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {150,187, 148,211, 150,233, 153,247, 148,267, 135,283, 125,299, + 136,292, 131,313, 122,328, 122,345, 129,352, 133,359, 133,367, + 137,359, 148,356, 140,350, 131,347, 129,340, 132,332, 140,328, + 137,322, 140,304, 154,265, 157,244, 155,223, 161,220, 175,229, + 186,247, 185,260, 176,275, 178,287, 185,277, 188,261, 196,253, + 189,236, 174,213 + }; + + init(l, 128, color, coords, ELEMENTS(coords)/2); +} + +static void poly129(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {147,338, 142,341, 143,345, 141,354, 147,343 + }; + + init(l, 129, color, coords, ELEMENTS(coords)/2); +} + +static void poly130(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {157,342, 156,349, 150,356, 157,353, 163,346, 162,342 + }; + + init(l, 130, color, coords, ELEMENTS(coords)/2); +} + +static void poly131(struct lion *l) +{ + VGfloat color = 0x000000; + static const VGfloat coords[] = {99,265, 96,284, 92,299, 73,339, 73,333, 87,300 + }; + + init(l, 131, color, coords, ELEMENTS(coords)/2); +} + + +struct lion * lion_create(void) +{ + struct lion *l = calloc(1, sizeof(struct lion)); + + poly0(l); + poly1(l); + poly2(l); + poly3(l); + poly4(l); + poly5(l); + poly6(l); + poly7(l); + poly8(l); + poly9(l); + + poly10(l); + poly11(l); + poly12(l); + poly13(l); + poly14(l); + poly15(l); + poly16(l); + poly17(l); + poly18(l); + poly19(l); + + poly20(l); + poly21(l); + poly22(l); + poly23(l); + poly24(l); + poly25(l); + poly26(l); + poly27(l); + poly28(l); + poly29(l); + + poly30(l); + poly31(l); + poly32(l); + poly33(l); + poly34(l); + poly35(l); + poly36(l); + poly37(l); + poly38(l); + poly39(l); + + poly40(l); + poly41(l); + poly42(l); + poly43(l); + poly44(l); + poly45(l); + poly46(l); + poly47(l); + poly48(l); + poly49(l); + + poly50(l); + poly51(l); + poly52(l); + poly53(l); + poly54(l); + poly55(l); + poly56(l); + poly57(l); + poly58(l); + poly59(l); + + poly60(l); + poly61(l); + poly62(l); + poly63(l); + poly64(l); + poly65(l); + poly66(l); + poly67(l); + poly68(l); + poly69(l); + + poly70(l); + poly71(l); + poly72(l); + poly73(l); + poly74(l); + poly75(l); + poly76(l); + poly77(l); + poly78(l); + poly79(l); + + poly80(l); + poly81(l); + poly82(l); + poly83(l); + poly84(l); + poly85(l); + poly86(l); + poly87(l); + poly88(l); + poly89(l); + + poly90(l); + poly91(l); + poly92(l); + poly93(l); + poly94(l); + poly95(l); + poly96(l); + poly97(l); + poly98(l); + poly99(l); + + poly100(l); + poly101(l); + poly102(l); + poly103(l); + poly104(l); + poly105(l); + poly106(l); + poly107(l); + poly108(l); + poly109(l); + + poly110(l); + poly111(l); + poly112(l); + poly113(l); + poly114(l); + poly115(l); + poly116(l); + poly117(l); + poly118(l); + poly119(l); + + poly120(l); + poly121(l); + poly122(l); + poly123(l); + poly124(l); + poly125(l); + poly126(l); + poly127(l); + poly128(l); + poly129(l); + + poly130(l); + poly131(l); + + return l; +} + +void lion_render(struct lion *l) +{ + VGint i; + + for (i = 0; i < LION_SIZE; ++i) { + vgSetPaint(l->fills[i], VG_FILL_PATH); + vgDrawPath(l->paths[i], VG_FILL_PATH); + } +} + +void lion_destroy(struct lion *l) +{ + VGint i; + for (i = 0; i < LION_SIZE; ++i) { + vgDestroyPaint(l->fills[i]); + vgDestroyPath(l->paths[i]); + } + free(l); +} diff --git a/progs/openvg/demos/lion-render.h b/progs/openvg/demos/lion-render.h new file mode 100644 index 0000000000..c4c020b7ed --- /dev/null +++ b/progs/openvg/demos/lion-render.h @@ -0,0 +1,16 @@ +#ifndef LION_RENDER_H +#define LION_RENDER_H + +#include <VG/openvg.h> + +#define LION_SIZE 132 +struct lion { + VGPath paths[LION_SIZE]; + VGPaint fills[LION_SIZE]; +}; + +struct lion *lion_create(void); +void lion_render(struct lion *l); +void lion_destroy(struct lion *l); + +#endif diff --git a/progs/openvg/demos/lion.c b/progs/openvg/demos/lion.c new file mode 100644 index 0000000000..7224fed399 --- /dev/null +++ b/progs/openvg/demos/lion.c @@ -0,0 +1,288 @@ +#include <assert.h> +#include <math.h> +#include <stdlib.h> +#include <stdio.h> +#include <string.h> +#include <X11/Xlib.h> +#include <X11/Xutil.h> +#include <X11/keysym.h> +#include <VG/openvg.h> +#include <GLES/egl.h> + +#include "lion-render.h" + +static VGint width, height; +struct lion *lion = 0; +VGfloat angle = 0; + +static void +draw(void) +{ + vgClear(0, 0, width, height); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + vgLoadIdentity(); + vgTranslate(width/2, height/2); + vgRotate(angle); + vgTranslate(-width/2, -height/2); + + lion_render(lion); + + ++angle; +} + + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + width = w; + height = h; +} + + +static void +init(void) +{ + float clear_color[4] = {1.0, 1.0, 1.0, 1.0}; + vgSetfv(VG_CLEAR_COLOR, 4, clear_color); + + lion = lion_create(); +} + + +/* + * Create an RGB, double-buffered X window. + * Return the window and context handles. + */ +static void +make_x_window(Display *x_dpy, EGLDisplay egl_dpy, + const char *name, + int x, int y, int width, int height, + Window *winRet, + EGLContext *ctxRet, + EGLSurface *surfRet) +{ + static const EGLint attribs[] = { + EGL_RED_SIZE, 1, + EGL_GREEN_SIZE, 1, + EGL_BLUE_SIZE, 1, + EGL_NONE + }; + + int scrnum; + XSetWindowAttributes attr; + unsigned long mask; + Window root; + Window win; + XVisualInfo *visInfo, visTemplate; + int num_visuals; + EGLContext ctx; + EGLConfig config; + EGLint num_configs; + EGLint vid; + + scrnum = DefaultScreen( x_dpy ); + root = RootWindow( x_dpy, scrnum ); + + if (!eglChooseConfig( egl_dpy, attribs, &config, 1, &num_configs)) { + printf("Error: couldn't get an EGL visual config\n"); + exit(1); + } + + assert(config); + assert(num_configs > 0); + + if (!eglGetConfigAttrib(egl_dpy, config, EGL_NATIVE_VISUAL_ID, &vid)) { + printf("Error: eglGetConfigAttrib() failed\n"); + exit(1); + } + + /* The X window visual must match the EGL config */ + visTemplate.visualid = vid; + visInfo = XGetVisualInfo(x_dpy, VisualIDMask, &visTemplate, &num_visuals); + if (!visInfo) { + printf("Error: couldn't get X visual\n"); + exit(1); + } + + /* window attributes */ + attr.background_pixel = 0; + attr.border_pixel = 0; + attr.colormap = XCreateColormap( x_dpy, root, visInfo->visual, AllocNone); + attr.event_mask = StructureNotifyMask | ExposureMask | KeyPressMask; + mask = CWBackPixel | CWBorderPixel | CWColormap | CWEventMask; + + win = XCreateWindow( x_dpy, root, 0, 0, width, height, + 0, visInfo->depth, InputOutput, + visInfo->visual, mask, &attr ); + + /* set hints and properties */ + { + XSizeHints sizehints; + sizehints.x = x; + sizehints.y = y; + sizehints.width = width; + sizehints.height = height; + sizehints.flags = USSize | USPosition; + XSetNormalHints(x_dpy, win, &sizehints); + XSetStandardProperties(x_dpy, win, name, name, + None, (char **)NULL, 0, &sizehints); + } + + eglBindAPI(EGL_OPENVG_API); + + ctx = eglCreateContext(egl_dpy, config, EGL_NO_CONTEXT, NULL ); + if (!ctx) { + printf("Error: eglCreateContext failed\n"); + exit(1); + } + + *surfRet = eglCreateWindowSurface(egl_dpy, config, win, NULL); + + if (!*surfRet) { + printf("Error: eglCreateWindowSurface failed\n"); + exit(1); + } + + XFree(visInfo); + + *winRet = win; + *ctxRet = ctx; +} + + +static void +event_loop(Display *dpy, Window win, + EGLDisplay egl_dpy, EGLSurface egl_surf) +{ + while (1) { + XEvent event; + + while (XPending(dpy) > 0) { + XNextEvent(dpy, &event); + + switch (event.type) { + case Expose: + break; + case ConfigureNotify: + reshape(event.xconfigure.width, event.xconfigure.height); + break; + case KeyPress: + { + char buffer[10]; + int r, code; + code = XLookupKeysym(&event.xkey, 0); + r = XLookupString(&event.xkey, buffer, sizeof(buffer), + NULL, NULL); + if (buffer[0] == 27) { + /* escape */ + return; + } + } + break; + default: + ; /*no-op*/ + } + } + + draw(); + eglSwapBuffers(egl_dpy, egl_surf); + } +} + + +static void +usage(void) +{ + printf("Usage:\n"); + printf(" -display <displayname> set the display to run on\n"); + printf(" -info display OpenGL renderer info\n"); +} + +int +main(int argc, char *argv[]) +{ + const int winWidth = 350, winHeight = 450; + Display *x_dpy; + Window win; + EGLSurface egl_surf; + EGLContext egl_ctx; + EGLDisplay egl_dpy; + char *dpyName = NULL; + GLboolean printInfo = GL_FALSE; + EGLint egl_major, egl_minor; + int i; + const char *s; + + for (i = 1; i < argc; i++) { + if (strcmp(argv[i], "-display") == 0) { + dpyName = argv[i+1]; + i++; + } + else if (strcmp(argv[i], "-info") == 0) { + printInfo = GL_TRUE; + } + else { + usage(); + return -1; + } + } + + x_dpy = XOpenDisplay(dpyName); + if (!x_dpy) { + printf("Error: couldn't open display %s\n", + dpyName ? dpyName : getenv("DISPLAY")); + return -1; + } + + egl_dpy = eglGetDisplay(x_dpy); + if (!egl_dpy) { + printf("Error: eglGetDisplay() failed\n"); + return -1; + } + + if (!eglInitialize(egl_dpy, &egl_major, &egl_minor)) { + printf("Error: eglInitialize() failed\n"); + return -1; + } + + s = eglQueryString(egl_dpy, EGL_VERSION); + printf("EGL_VERSION = %s\n", s); + + make_x_window(x_dpy, egl_dpy, + "Lion Example", 0, 0, winWidth, winHeight, + &win, &egl_ctx, &egl_surf); + + XMapWindow(x_dpy, win); + if (!eglMakeCurrent(egl_dpy, egl_surf, egl_surf, egl_ctx)) { + printf("Error: eglMakeCurrent() failed\n"); + return -1; + } + + if (printInfo) { + printf("VG_RENDERER = %s\n", (char *) vgGetString(VG_RENDERER)); + printf("VG_VERSION = %s\n", (char *) vgGetString(VG_VERSION)); + printf("VG_VENDOR = %s\n", (char *) vgGetString(VG_VENDOR)); + } + + init(); + + /* Set initial projection/viewing transformation. + * We can't be sure we'll get a ConfigureNotify event when the window + * first appears. + */ + reshape(winWidth, winHeight); + + event_loop(x_dpy, win, egl_dpy, egl_surf); + + eglDestroyContext(egl_dpy, egl_ctx); + eglDestroySurface(egl_dpy, egl_surf); + eglTerminate(egl_dpy); + + + XDestroyWindow(x_dpy, win); + XCloseDisplay(x_dpy); + + return 0; +} diff --git a/progs/openvg/demos/sp.c b/progs/openvg/demos/sp.c new file mode 100644 index 0000000000..d04f252e2e --- /dev/null +++ b/progs/openvg/demos/sp.c @@ -0,0 +1,103 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> +#include <VG/vgu.h> +#include <stdio.h> +#include <math.h> +#include <stdlib.h> + +#include <X11/keysym.h> + +struct object { + VGPath path; + VGPaint fill; + VGPaint stroke; + VGint draw_mode; +}; + +struct character { + struct object objects[32]; + VGint num_objects; +}; + +struct character cartman; + +static void init_character() +{ + struct object object; + VGint num_objects = 0; + + { + const VGint num_segments = 6; + const VGubyte segments[] = {VG_MOVE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CLOSE_PATH}; + const VGfloat coords[] = {181.83267, 102.60408, + 181.83267,102.60408 185.53793,114.5749 186.5355,115.00243, + 187.53306,115.42996 286.0073,115.00243 286.0073,115.00243, + 286.0073,115.00243 292.70526,103.45914 290.85263,101.03648, + 289.00001,98.61381 181.54765,102.31906 181.83267,102.60408 + }; + VGuint color = 0x7c4e32ff; + object.path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + vgAppendPathData(object.path, num_segments, segments, coords); + + object.fill = vgCreatePaint(); + vgSetColor(object.fill, color); + character.objects[objects.num_objects] = object; + ++objects.num_objects; + } + { + + } +} + + +static void +init(void) +{ +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +int key_press(unsigned key) +{ + switch(key) { + case XK_Right: + + break; + case XK_Left: + break; + case XK_Up: + break; + case XK_Down: + break; + case 'a': + break; + case 's': + break; + default: + break; + } + return VG_FALSE; +} + +static void +draw(void) +{ +} + + +int main(int argc, char **argv) +{ + set_window_size(400, 400); + return run(argc, argv, init, reshape, draw, key_press); +} diff --git a/progs/openvg/trivial/Makefile b/progs/openvg/trivial/Makefile new file mode 100644 index 0000000000..362360e596 --- /dev/null +++ b/progs/openvg/trivial/Makefile @@ -0,0 +1,127 @@ +# These programs aren't intended to be included with the normal distro. +# They're not too interesting but they're good for testing. + +TOP = ../../../ +include $(TOP)/configs/current + +INCLUDES = -I. -I$(TOP)/include +LIBS=-L$(TOP)/$(LIB_DIR) -lm -lEGL -lOpenVG -lpthread +CFLAGS += $(INCLUDES) + +HEADERS=eglcommon.h + +PROGRAMS = \ + arc \ + cap \ + clear \ + coord \ + dash \ + ellipse \ + filter \ + gradorigin \ + lineto \ + lingrad \ + lookup \ + mask4 \ + mask \ + path3 \ + radialgrad \ + readpixels \ + roundedrect \ + star-nonzero \ + star-oddeven \ + stroke2 \ + stroke \ + vguarc + + +.c.o: + $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@ + + + +default: $(PROGRAMS) + + +arc: arc.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +cap: cap.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +clear: clear.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +coord: coord.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +dash: dash.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +ellipse: ellipse.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +filter: filter.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +gradorigin: gradorigin.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +image: image.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +lineto: lineto.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +lingrad: lingrad.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +lookup: lookup.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +mask: mask.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +mask4: mask4.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +path3: path3.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +pattern: pattern.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +radialgrad: radialgrad.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +readpixels: readpixels.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +roundedrect: roundedrect.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +star-nonzero: star-nonzero.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +star-oddeven: star-oddeven.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +stroke: stroke.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +stroke2: stroke2.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + +vguarc: vguarc.c eglcommon.o + $(CC) $(CFLAGS) $^ $(LIBS) $(APP_LIB_DEPS) -o $@ + + + +eglcommon.o: eglcommon.c $(HEADERS) + $(CC) -c $(CFLAGS) eglcommon.c + + +clean: + rm -f *.o *~ + rm -f *.so + rm -f $(PROGRAMS) diff --git a/progs/openvg/trivial/arc.c b/progs/openvg/trivial/arc.c new file mode 100644 index 0000000000..db686bea6b --- /dev/null +++ b/progs/openvg/trivial/arc.c @@ -0,0 +1,139 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> +#include <math.h> + +const VGfloat clear_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {1.0, 1.0, 1.0, 0.5}; + +VGPath vgPath; + +static void ellipse(VGPath vgPath, VGfloat rx, VGfloat ry, VGfloat angle) +{ + static const VGubyte cmd[] = + { VG_MOVE_TO_ABS, VG_SCCWARC_TO_REL, VG_SCCWARC_TO_REL, VG_CLOSE_PATH }; + + VGfloat val[12]; + VGfloat c = cos(angle) * rx; + VGfloat s = sin(angle) * rx; + + val[0] = c; + val[1] = s; + val[2] = rx; + val[3] = ry; + val[4] = angle; + val[5] = -2.0f * c; + val[6] = -2.0f * s; + val[7] = rx; + val[8] = ry; + val[9] = angle; + val[10] = 2.0f * c; + val[11] = 2.0f * s; + + vgClearPath(vgPath, VG_PATH_CAPABILITY_ALL); + vgAppendPathData(vgPath, sizeof(cmd), cmd, val); + vgDrawPath(vgPath, VG_FILL_PATH | VG_STROKE_PATH); +} + +static void +init(void) +{ + VGPaint vgPaint; + + vgSetfv(VG_CLEAR_COLOR, 4, clear_color); + vgPath = vgCreatePath(VG_PATH_FORMAT_STANDARD, + VG_PATH_DATATYPE_F, 1.0f, 0.0f, 0, 0, + VG_PATH_CAPABILITY_ALL); + + vgPaint = vgCreatePaint(); + vgSetParameteri(vgPaint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + vgSetColor(vgPaint, 0x00ff00ff); + vgSetPaint(vgPaint, VG_FILL_PATH); + + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + vgSeti(VG_BLEND_MODE, VG_BLEND_SRC_OVER); + vgSetf(VG_STROKE_LINE_WIDTH, 2.0f); + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_SQUARE); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_MITER); + vgSetf(VG_STROKE_MITER_LIMIT, 4.0f); + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + +#if 0 + vgLoadIdentity(); + vgTranslate(40.0f, 24.0f); + vgScale(0.61804f, 0.61804f); + vgShear(-1.0f, 0.0f); + vgDrawPath(vgPath, VG_FILL_PATH | VG_STROKE_PATH); +#else + + /* row 1, col 1: Identity transform. */ + + vgLoadIdentity(); + vgTranslate(8.0f, 8.0f); + ellipse(vgPath, 4.0f, 4.0f, 0.0f); + + /* row 1, col 2: 10^3 horizontal squeeze. */ + + vgLoadIdentity(); + vgTranslate(24.0f, 8.0f); + vgScale(1.0e-3f, 1.0f); + ellipse(vgPath, 4.0e3f, 4.0f, 0.0f); + + /* row 1, col 3: 10^6 horizontal squeeze. */ + + vgLoadIdentity(); + vgTranslate(40.0f, 8.0f); + vgScale(1.0e-6f, 1.0f); + ellipse(vgPath, 4.0e6f, 4.0f, 0.0f); + + /* row 1, col 4: 10^9 horizontal squeeze. */ + + vgLoadIdentity(); + vgTranslate(56.0f, 8.0f); + vgScale(1.0e-9f, 1.0f); + ellipse(vgPath, 4.0e9f, 4.0f, 0.0f); + + /* row 2, col 1: 10^3 vertical squeeze. */ + + vgLoadIdentity(); + vgTranslate(8.0f, 24.0f); + vgScale(1.0f, 1.0e-3f); + ellipse(vgPath, 4.0f, 4.0e3f, 0.0f); + + /* row 2, col 2: Shear 0. */ + + vgLoadIdentity(); + vgTranslate(24.0f, 24.0f); + vgShear(0.0f, 0.0f); + ellipse(vgPath, 4.0f, 4.0f, 0.0f); + + /* row 2, col 3: Horizontal shear -1. */ + + vgLoadIdentity(); + vgTranslate(40.0f, 24.0f); + vgScale(0.61804f, 0.61804f); + vgShear(-1.0f, 0.0f); + ellipse(vgPath, 10.47213f, 4.0f, 31.717f); +#endif + vgFlush(); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/cap.c b/progs/openvg/trivial/cap.c new file mode 100644 index 0000000000..cd84fe3ac0 --- /dev/null +++ b/progs/openvg/trivial/cap.c @@ -0,0 +1,75 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +#include <math.h> +#include <stdlib.h> +#include <stdio.h> + +static void +init(void) +{ + +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +const int subtest = 0; +static void +draw(void) +{ + VGPath line; + VGPaint fillPaint; + VGubyte lineCommands[3] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS}; + VGfloat lineCoords[] = {-2.0f,-1.0f, 0.0f,0.0f, -1.0f, -2.0f}; + VGfloat clearColor[] = {0.0f, 0.0f, 0.0f, 1.0f};/* black color */ + VGfloat fillColor[] = {1.0f, 1.0f, 1.0f, 1.0f};/* white color */ + //VGfloat testRadius = 60.0f; + VGfloat testRadius = 10.0f; + int WINDSIZEX = window_width(); + int WINDSIZEY = window_height(); + + line = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL); + fillPaint = vgCreatePaint(); + + vgSetf(VG_STROKE_LINE_WIDTH, 1.0f); + //vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_ROUND); + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND); + //vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_BEVEL); + + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_BETTER); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + vgLoadIdentity(); + vgTranslate(60, 60); + vgScale(testRadius * 2, testRadius * 2); + + vgAppendPathData(line, 3, lineCommands, lineCoords); + + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + + vgSetPaint(fillPaint, VG_STROKE_PATH); + + vgSetParameterfv(fillPaint, VG_PAINT_COLOR, 4, fillColor); + vgSetParameteri( fillPaint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + + vgClear(0, 0, WINDSIZEX, WINDSIZEY); + vgDrawPath(line, VG_STROKE_PATH); + + vgDestroyPath(line); + vgDestroyPaint(fillPaint); +} + + +int main(int argc, char **argv) +{ + set_window_size(100, 100); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/clear.c b/progs/openvg/trivial/clear.c new file mode 100644 index 0000000000..efb6bf4182 --- /dev/null +++ b/progs/openvg/trivial/clear.c @@ -0,0 +1,42 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> +#include <stdio.h> + +float red_color[4] = {1.0, 0.0, 0.0, 1.0}; +float blue_color[4] = {0.0, 0.0, 1.0, 1.0}; + +static void +init(void) +{ +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + VGint scissor[4] = {100, 100, 25, 25}; + vgSetfv(VG_CLEAR_COLOR, 4, red_color); + vgClear(0, 0, window_width(), window_height()); + + vgSetfv(VG_CLEAR_COLOR, 4, blue_color); + vgClear(50, 50, 50, 50); + + //vgSetiv(VG_SCISSOR_RECTS, 4, scissor); + //vgSeti(VG_SCISSORING, VG_TRUE); + vgCopyPixels(100, 100, 50, 50, 50, 50); + vgClear(150, 150, 50, 50); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/coord.c b/progs/openvg/trivial/coord.c new file mode 100644 index 0000000000..81f7cb6fc9 --- /dev/null +++ b/progs/openvg/trivial/coord.c @@ -0,0 +1,66 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + /* Absent VG_CLOSE_PATH */ + VGubyte commands[] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, + VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS}; + VGfloat clearColor[] = {1.0f, 1.0f, 1.0f, 1.0f};/* white color */ + VGfloat fillColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */ + VGfloat coords[] = {-16.0f, -16.0f, 0.0f, -16.0f, 0.0f, 0.0f, -16.0f, 0.0f, + 0.0f, 0.0f, 16.0f, 0.0f, 16.0f, 16.0f, 0.0f, 16.0f}; + + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + vgLoadIdentity(); + vgTranslate(32.0f, 32.0f); + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1.0f, 0.0f, 0, 0, + VG_PATH_CAPABILITY_ALL); + if (path == VG_INVALID_HANDLE) + return; + fill = vgCreatePaint(); + if (fill == VG_INVALID_HANDLE) { + vgDestroyPath(path); + return; + } + vgAppendPathData(path, 8, commands, coords); + vgSetPaint(fill, VG_FILL_PATH); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, fillColor); + vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/dash.c b/progs/openvg/trivial/dash.c new file mode 100644 index 0000000000..2e84ddbd4e --- /dev/null +++ b/progs/openvg/trivial/dash.c @@ -0,0 +1,95 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> +#include <X11/keysym.h> +#include <stdio.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + +VGint cap_style = VG_CAP_BUTT; + +static void +init(void) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_LINE_TO_ABS, + VG_LINE_TO_ABS + }; +#if 1 + static const VGfloat coords[] = {100, 100, 150, 100, + 150, 200 + }; +#else + static const VGfloat coords[] = {100, 20, 100, 220, + }; +#endif + VGfloat dash_pattern[2] = { 20.f, 20.f }; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 3, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 20); + vgSeti(VG_STROKE_CAP_STYLE, cap_style); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND); + vgSetfv(VG_STROKE_DASH_PATTERN, 2, dash_pattern); + vgSetf(VG_STROKE_DASH_PHASE, 0.0f); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_STROKE_PATH); + + vgFlush(); +} + +static int key_press(unsigned key) +{ + switch(key) { + case XK_c: + case XK_C: + ++cap_style; + if (cap_style > VG_CAP_SQUARE) + cap_style = VG_CAP_BUTT; + switch(cap_style) { + case VG_CAP_BUTT: + fprintf(stderr, "Cap style 'butt'\n"); + break; + case VG_CAP_ROUND: + fprintf(stderr, "Cap style 'round'\n"); + break; + case VG_CAP_SQUARE: + fprintf(stderr, "Cap style 'square'\n"); + break; + } + vgSeti(VG_STROKE_CAP_STYLE, cap_style); + break; + default: + break; + } + + return VG_TRUE; +} + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, key_press); +} diff --git a/progs/openvg/trivial/eglcommon.c b/progs/openvg/trivial/eglcommon.c new file mode 100644 index 0000000000..bacd5685d7 --- /dev/null +++ b/progs/openvg/trivial/eglcommon.c @@ -0,0 +1,288 @@ +#include "eglcommon.h" + + +#include <assert.h> +#include <math.h> +#include <stdlib.h> +#include <stdio.h> +#include <string.h> +#include <X11/Xlib.h> +#include <X11/Xutil.h> +#include <X11/keysym.h> +#include <VG/openvg.h> /* using full OpenGL for now */ +#include <GLES/egl.h> + + +static init_func init = 0; +static draw_func draw = 0; +static reshape_func reshape = 0; +static key_func keyPress = 0; +static VGint width = 300, height = 300; + + +void set_window_size(int w, int h) +{ + width = w; + height = h; +} + +/* + * Create an RGB, double-buffered X window. + * Return the window and context handles. + */ +static void +make_x_window(Display *x_dpy, EGLDisplay egl_dpy, + const char *name, + int x, int y, int width, int height, + Window *winRet, + EGLContext *ctxRet, + EGLSurface *surfRet) +{ + static const EGLint attribs[] = { + EGL_RED_SIZE, 1, + EGL_GREEN_SIZE, 1, + EGL_BLUE_SIZE, 1, + EGL_NONE + }; + + int scrnum; + XSetWindowAttributes attr; + unsigned long mask; + Window root; + Window win; + XVisualInfo *visInfo, visTemplate; + int num_visuals; + EGLContext ctx; + EGLConfig config; + EGLint num_configs; + EGLint vid; + + scrnum = DefaultScreen( x_dpy ); + root = RootWindow( x_dpy, scrnum ); + + if (!eglChooseConfig( egl_dpy, attribs, &config, 1, &num_configs)) { + printf("Error: couldn't get an EGL visual config\n"); + exit(1); + } + + assert(config); + assert(num_configs > 0); + + if (!eglGetConfigAttrib(egl_dpy, config, EGL_NATIVE_VISUAL_ID, &vid)) { + printf("Error: eglGetConfigAttrib() failed\n"); + exit(1); + } + + /* The X window visual must match the EGL config */ + visTemplate.visualid = vid; + visInfo = XGetVisualInfo(x_dpy, VisualIDMask, &visTemplate, &num_visuals); + if (!visInfo) { + printf("Error: couldn't get X visual\n"); + exit(1); + } + + /* window attributes */ + attr.background_pixel = 0; + attr.border_pixel = 0; + attr.colormap = XCreateColormap( x_dpy, root, visInfo->visual, AllocNone); + attr.event_mask = StructureNotifyMask | ExposureMask | KeyPressMask; + mask = CWBackPixel | CWBorderPixel | CWColormap | CWEventMask; + + win = XCreateWindow( x_dpy, root, 0, 0, width, height, + 0, visInfo->depth, InputOutput, + visInfo->visual, mask, &attr ); + + /* set hints and properties */ + { + XSizeHints sizehints; + sizehints.x = x; + sizehints.y = y; + sizehints.width = width; + sizehints.height = height; + sizehints.flags = USSize | USPosition; + XSetNormalHints(x_dpy, win, &sizehints); + XSetStandardProperties(x_dpy, win, name, name, + None, (char **)NULL, 0, &sizehints); + } + + eglBindAPI(EGL_OPENVG_API); + + ctx = eglCreateContext(egl_dpy, config, EGL_NO_CONTEXT, NULL ); + if (!ctx) { + printf("Error: eglCreateContext failed\n"); + exit(1); + } + + *surfRet = eglCreateWindowSurface(egl_dpy, config, win, NULL); + + if (!*surfRet) { + printf("Error: eglCreateWindowSurface failed\n"); + exit(1); + } + + XFree(visInfo); + + *winRet = win; + *ctxRet = ctx; +} + +static void +event_loop(Display *dpy, Window win, + EGLDisplay egl_dpy, EGLSurface egl_surf) +{ + while (1) { + int redraw = 0; + XEvent event; + + XNextEvent(dpy, &event); + + switch (event.type) { + case Expose: + redraw = 1; + break; + case ConfigureNotify: + if (reshape) { + width = event.xconfigure.width; + height = event.xconfigure.height; + reshape(event.xconfigure.width, event.xconfigure.height); + } + break; + case KeyPress: + { + char buffer[10]; + int r, code; + code = XLookupKeysym(&event.xkey, 0); + if (!keyPress || !keyPress(code)) { + r = XLookupString(&event.xkey, buffer, sizeof(buffer), + NULL, NULL); + if (buffer[0] == 27) { + /* escape */ + return; + } + } + } + redraw = 1; + break; + default: + ; /*no-op*/ + } + + if (redraw) { + draw(); + eglSwapBuffers(egl_dpy, egl_surf); + } + } +} + +int window_width(void) +{ + return width; +} + +int window_height(void) +{ + return height; +} + +static void +usage(void) +{ + printf("Usage:\n"); + printf(" -display <displayname> set the display to run on\n"); + printf(" -info display OpenGL renderer info\n"); +} + +int run(int argc, char **argv, + init_func init_f, + reshape_func resh_f, + draw_func draw_f, + key_func key_f) +{ + const int winWidth = width, winHeight = height; + Display *x_dpy; + Window win; + EGLSurface egl_surf; + EGLContext egl_ctx; + EGLDisplay egl_dpy; + char *dpyName = NULL; + GLboolean printInfo = GL_FALSE; + EGLint egl_major, egl_minor; + int i; + const char *s; + + init = init_f; + draw = draw_f; + reshape = resh_f; + keyPress = key_f; + + for (i = 1; i < argc; i++) { + if (strcmp(argv[i], "-display") == 0) { + dpyName = argv[i+1]; + i++; + } + else if (strcmp(argv[i], "-info") == 0) { + printInfo = GL_TRUE; + } + } + + x_dpy = XOpenDisplay(dpyName); + if (!x_dpy) { + printf("Error: couldn't open display %s\n", + dpyName ? dpyName : getenv("DISPLAY")); + return -1; + } + + egl_dpy = eglGetDisplay(x_dpy); + if (!egl_dpy) { + printf("Error: eglGetDisplay() failed\n"); + return -1; + } + + if (!eglInitialize(egl_dpy, &egl_major, &egl_minor)) { + printf("Error: eglInitialize() failed\n"); + return -1; + } + + s = eglQueryString(egl_dpy, EGL_VERSION); + printf("EGL_VERSION = %s\n", s); + + make_x_window(x_dpy, egl_dpy, + "OpenVG Example", 0, 0, winWidth, winHeight, + &win, &egl_ctx, &egl_surf); + + XMapWindow(x_dpy, win); + if (!eglMakeCurrent(egl_dpy, egl_surf, egl_surf, egl_ctx)) { + printf("Error: eglMakeCurrent() failed\n"); + return -1; + } + + if (printInfo) { + printf("VG_RENDERER = %s\n", (char *) vgGetString(VG_RENDERER)); + printf("VG_VERSION = %s\n", (char *) vgGetString(VG_VERSION)); + printf("VG_VENDOR = %s\n", (char *) vgGetString(VG_VENDOR)); + } + + if (init) + init(); + + /* Set initial projection/viewing transformation. + * We can't be sure we'll get a ConfigureNotify event when the window + * first appears. + */ + if (reshape) + reshape(winWidth, winHeight); + + event_loop(x_dpy, win, egl_dpy, egl_surf); + + eglMakeCurrent(egl_dpy, 0, 0, 0); + eglDestroyContext(egl_dpy, egl_ctx); + eglDestroySurface(egl_dpy, egl_surf); + eglTerminate(egl_dpy); + + + XDestroyWindow(x_dpy, win); + XCloseDisplay(x_dpy); + + return 0; +} + diff --git a/progs/openvg/trivial/eglcommon.h b/progs/openvg/trivial/eglcommon.h new file mode 100644 index 0000000000..958dae9f98 --- /dev/null +++ b/progs/openvg/trivial/eglcommon.h @@ -0,0 +1,20 @@ +#ifndef EGLCOMMON_H +#define EGLCOMMON_H + +typedef void (*init_func)(); +typedef void (*reshape_func)(int, int); +typedef void (*draw_func)(); +typedef int (*key_func)(unsigned key); + + +void set_window_size(int width, int height); +int window_width(void); +int window_height(void); + +int run(int argc, char **argv, + init_func init, + reshape_func resh, + draw_func draw, + key_func key); + +#endif diff --git a/progs/openvg/trivial/ellipse.c b/progs/openvg/trivial/ellipse.c new file mode 100644 index 0000000000..4c7d4904f8 --- /dev/null +++ b/progs/openvg/trivial/ellipse.c @@ -0,0 +1,84 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +#include <math.h> +#include <stdlib.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.0, 0.0, 0.0, 1.0}; + +VGPath path; +VGPaint paint; + +static void +init(void) +{ + VGfloat clearColor[] = {1.0f, 1.0f, 1.0f, 1.0f};/* white color */ + VGfloat fillColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */ + static const VGubyte segments[4] = {VG_MOVE_TO_ABS, + VG_SCCWARC_TO_ABS, + VG_SCCWARC_TO_ABS, + VG_CLOSE_PATH}; + VGfloat data[12]; + const VGfloat cx = 0, cy=29, width=80, height=40; + const VGfloat hw = width * 0.5f; + const VGfloat hh = height * 0.5f; + + data[0] = cx + hw; + data[1] = cy; + data[2] = hw; + data[3] = hh; + data[4] = 0; + data[5] = cx - hw; + data[6] = cy; + data[7] = hw; + data[8] = hh; + data[9] = 0; + data[10] = data[0]; + data[11] = cy; + + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL); + if (path == VG_INVALID_HANDLE) { + return; + } + paint = vgCreatePaint(); + if (paint == VG_INVALID_HANDLE) { + vgDestroyPath(path); + return; + } + + vgAppendPathData(path, 4, segments, data); + vgSetParameterfv(paint, VG_PAINT_COLOR, 4, fillColor); + vgSetParameteri( paint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + vgSetPaint(paint, VG_FILL_PATH); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgLoadIdentity(); + vgTranslate(50, 21); + vgDrawPath(path, VG_FILL_PATH); + vgFlush(); +} + + +int main(int argc, char **argv) +{ + set_window_size(100, 100); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/filter.c b/progs/openvg/trivial/filter.c new file mode 100644 index 0000000000..d96257a933 --- /dev/null +++ b/progs/openvg/trivial/filter.c @@ -0,0 +1,107 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +#include <math.h> +#include <stdlib.h> +#include <stdio.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {1.0, 1.0, 1.0, 0.5}; + +VGImage srcImg; +VGImage dstImg; + +VGPaint fill; + +VGfloat bgCol[4] = {0.906f, 0.914f, 0.761f, 1.0f}; + +static void +init(void) +{ + VGfloat red[4]; + VGfloat grey[4]; + VGfloat orange[4]; + VGfloat blue[4]; + VGfloat black[4]; + VGfloat white[4]; + VGshort transKernel[49] = {0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0}; + + red[0] = 0.6710f; + red[1] = 0.1060f; + red[2] = 0.1330f; + red[3] = 1.0f; + + grey[0] = 0.6347f; + grey[1] = 0.6561f; + grey[2] = 0.6057f; + grey[3] = 1.0f; + + orange[0] = 1.0000f; + orange[1] = 0.8227f; + orange[2] = 0.5057f; + orange[3] = 1.0f; + + blue[0] = 0.0000f; + blue[1] = 0.6908f; + blue[2] = 0.8595f; + blue[3] = 1.0f; + + black[0] = 0; + black[1] = 0; + black[2] = 0; + black[3] = 1.0f; + + white[0] = 1; + white[1] = 1; + white[2] = 1; + white[3] = 1.0f; + + vgSetfv(VG_TILE_FILL_COLOR, 4, blue); + + vgSeti(VG_FILTER_CHANNEL_MASK, 14); + + /* Setup images */ + srcImg = vgCreateImage(VG_sRGBA_8888, 32, 32, + VG_IMAGE_QUALITY_NONANTIALIASED); + dstImg = vgCreateImage(VG_sRGBA_8888, 32, 32, + VG_IMAGE_QUALITY_NONANTIALIASED); + + vgSetfv(VG_CLEAR_COLOR, 4, black); + vgClearImage(srcImg, 0, 0, 32, 32); + vgSetfv(VG_CLEAR_COLOR, 4, red); + vgClearImage(srcImg, 3, 3, 27, 27); + + vgSetfv(VG_CLEAR_COLOR, 4, orange); + vgClearImage(dstImg, 0, 0, 32, 32); + + transKernel[8] = 1; + vgConvolve(dstImg, srcImg, 3, 3, 3, 0, transKernel, + 1, 0, VG_TILE_FILL); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgSetfv(VG_CLEAR_COLOR, 4, bgCol); + vgClear(0, 0, window_width(), window_height()); + vgSeti(VG_MATRIX_MODE, VG_MATRIX_IMAGE_USER_TO_SURFACE); + vgLoadIdentity(); + vgTranslate(10, 10); + vgDrawImage(dstImg); + vgFlush(); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/gradorigin.c b/progs/openvg/trivial/gradorigin.c new file mode 100644 index 0000000000..b376263fe5 --- /dev/null +++ b/progs/openvg/trivial/gradorigin.c @@ -0,0 +1,98 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +#include <stdio.h> +#include <string.h> + +static const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; + +static VGPath path; +static VGPaint fill; + +VGColorRampSpreadMode spread = VG_COLOR_RAMP_SPREAD_PAD; + +static void +init(void) +{ + VGubyte commands[5] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_CLOSE_PATH}; + VGfloat coords[8] = {0.0f,0.0f, 32.0f,0.0f, 32.0f,32.0f, 0.0f,32.0f }; + + VGfloat rampStop[20] = {-0.5f, 1.0f, 1.0f, 1.0f, 1.0f, + 0.25f, 1.0f, 0.0f, 0.0f, 1.0f, + 0.75f, 0.0f, 0.0f, 1.0f, 1.0f, + 1.5f, 0.0f, 0.0f, 0.0f, 0.0f}; + + VGfloat defaultColor[] = {1.0f, 1.0f, 1.0f, 1.0f}; + VGfloat linearGradient[4] = {0.0f, 0.0f, 0.0f, 32.0f}; + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL); + if (path == VG_INVALID_HANDLE) + return; + + fill = vgCreatePaint(); + if (fill == VG_INVALID_HANDLE) { + vgDestroyPath(path); + return; + } + + vgSetfv(VG_CLEAR_COLOR, 4, defaultColor); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + vgAppendPathData(path, 5, commands, coords); + + vgSetPaint(fill, VG_FILL_PATH); + vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_LINEAR_GRADIENT); + vgSetParameteri(fill, VG_PAINT_COLOR_RAMP_SPREAD_MODE, + VG_COLOR_RAMP_SPREAD_REPEAT); + vgSetParameterfv(fill, VG_PAINT_LINEAR_GRADIENT, 4, linearGradient); + vgSetParameterfv(fill, VG_PAINT_COLOR_RAMP_STOPS, 20, rampStop); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + if (argc > 1) { + const char *arg = argv[1]; + if (!strcmp("-pad", arg)) + spread = VG_COLOR_RAMP_SPREAD_PAD; + else if (!strcmp("-repeat", arg)) + spread = VG_COLOR_RAMP_SPREAD_REPEAT; + else if (!strcmp("-reflect", arg)) + spread = VG_COLOR_RAMP_SPREAD_REFLECT; + } + + switch(spread) { + case VG_COLOR_RAMP_SPREAD_PAD: + printf("Using spread mode: pad\n"); + break; + case VG_COLOR_RAMP_SPREAD_REPEAT: + printf("Using spread mode: repeat\n"); + break; + case VG_COLOR_RAMP_SPREAD_REFLECT: + printf("Using spread mode: reflect\n"); + } + + set_window_size(200, 200); + + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/lineto.c b/progs/openvg/trivial/lineto.c new file mode 100644 index 0000000000..94e2981811 --- /dev/null +++ b/progs/openvg/trivial/lineto.c @@ -0,0 +1,56 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat sqrCoords[5] = {50.0f, 50.0f, 250.0f, 250.0f, 50.0f}; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 5, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 10); + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND); + vgSetf(VG_STROKE_MITER_LIMIT, 4.0f); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgSeti(VG_MATRIX_MODE, VG_MATRIX_STROKE_PAINT_TO_USER); + vgLoadIdentity(); + vgScale(2.25, 2.25); + vgDrawPath(path, VG_STROKE_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/lingrad.c b/progs/openvg/trivial/lingrad.c new file mode 100644 index 0000000000..bcaad1f101 --- /dev/null +++ b/progs/openvg/trivial/lingrad.c @@ -0,0 +1,87 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +#include <stdio.h> +#include <string.h> + +static const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; + +static VGPath path; +static VGPaint fill; + +VGColorRampSpreadMode spread = VG_COLOR_RAMP_SPREAD_PAD; + +static void +init(void) +{ + static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat sqrCoords[5] = {0.0f, 0.0f, 400.0f, 400.0f, 0.0f}; + + VGfloat rampStop[] = {0.00f, 1.0f, 1.0f, 1.0f, 1.0f, + 0.33f, 1.0f, 0.0f, 0.0f, 1.0f, + 0.66f, 0.0f, 1.0f, 0.0f, 1.0f, + 1.00f, 0.0f, 0.0f, 1.0f, 1.0f}; + VGfloat linearGradient[4] = {100.0f, 100.0f, 300.0f, 300.0f}; + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 5, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_LINEAR_GRADIENT); + vgSetParameteri(fill, VG_PAINT_COLOR_RAMP_SPREAD_MODE, spread); + vgSetParameterfv(fill, VG_PAINT_LINEAR_GRADIENT, 4, linearGradient); + vgSetParameterfv(fill, VG_PAINT_COLOR_RAMP_STOPS, 20, rampStop); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + if (argc > 1) { + const char *arg = argv[1]; + if (!strcmp("-pad", arg)) + spread = VG_COLOR_RAMP_SPREAD_PAD; + else if (!strcmp("-repeat", arg)) + spread = VG_COLOR_RAMP_SPREAD_REPEAT; + else if (!strcmp("-reflect", arg)) + spread = VG_COLOR_RAMP_SPREAD_REFLECT; + } + + switch(spread) { + case VG_COLOR_RAMP_SPREAD_PAD: + printf("Using spread mode: pad\n"); + break; + case VG_COLOR_RAMP_SPREAD_REPEAT: + printf("Using spread mode: repeat\n"); + break; + case VG_COLOR_RAMP_SPREAD_REFLECT: + printf("Using spread mode: reflect\n"); + } + + set_window_size(400, 400); + + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/lookup.c b/progs/openvg/trivial/lookup.c new file mode 100644 index 0000000000..a103ba4488 --- /dev/null +++ b/progs/openvg/trivial/lookup.c @@ -0,0 +1,71 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +#include <math.h> +#include <stdlib.h> +#include <stdio.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {1.0, 1.0, 1.0, 0.5}; +VGfloat clearColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */ +VGImage parent; + +VGPaint fill; + +static void +init(void) +{ + VGImage child1, child2; + VGubyte *data; + VGuint LUT[256]; + VGint i; + + data = (VGubyte *)malloc(sizeof(VGubyte)*window_width()*window_height()); + + for (i=0;i<window_width()*window_height();i++) { + data[i] = 0x00; + } + + for (i=0; i<256; i++) { + if ( i == 0 ) + LUT[0] = 0xFFFFFFFF; + else + LUT[i] = 0xFF00FFFF; + } + + parent = vgCreateImage( VG_A_8, 64, 64, VG_IMAGE_QUALITY_NONANTIALIASED ); + + vgImageSubData(parent, data, window_width(), VG_A_8, 0, 0, + window_width(), window_height()); + child1 = vgChildImage(parent, 0, 0, 32, 64); + child2 = vgChildImage(parent, 32, 0, 32, 64); + + vgLookupSingle(child2, child1, LUT, VG_GREEN, VG_FALSE, VG_TRUE); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + vgClear(0, 0, window_width(), window_height()); + //vgSeti(VG_MATRIX_MODE, VG_MATRIX_IMAGE_USER_TO_SURFACE); + //vgLoadIdentity(); + //vgTranslate(10, 10); + vgDrawImage(parent); + vgFlush(); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/mask.c b/progs/openvg/trivial/mask.c new file mode 100644 index 0000000000..e5c00c5699 --- /dev/null +++ b/progs/openvg/trivial/mask.c @@ -0,0 +1,58 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat sqrCoords[5] = {50.0f, 50.0f, 250.0f, 250.0f, 50.0f}; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 5, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 10); + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_ROUND); + vgSetf(VG_STROKE_MITER_LIMIT, 4.0f); + + vgSeti(VG_MASKING, VG_TRUE); + + vgMask(VG_INVALID_HANDLE, VG_CLEAR_MASK, + 25, 25, 100, 100); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/mask4.c b/progs/openvg/trivial/mask4.c new file mode 100644 index 0000000000..fe6db39648 --- /dev/null +++ b/progs/openvg/trivial/mask4.c @@ -0,0 +1,132 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> +#include <VG/vgu.h> +#include <stdio.h> +#include <math.h> +#include <stdlib.h> + +#include <X11/keysym.h> + +//VGint x_pos = -10, y_pos = -10; +VGint x_pos = 0, y_pos = 4; +VGint img_width = 120, img_height = 120; + +static void RectToPath(VGPath path, VGfloat x, VGfloat y, VGfloat width, VGfloat height) +{ + static const VGubyte segments[5] = {VG_MOVE_TO_ABS, + VG_HLINE_TO_ABS, + VG_VLINE_TO_ABS, + VG_HLINE_TO_ABS, + VG_CLOSE_PATH}; + VGfloat data[5]; + + data[0] = x; + data[1] = y; + data[2] = x + width; + data[3] = y + height; + data[4] = x; + + vgAppendPathData(path, 5, segments, data); +} + +static void +init(void) +{ +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +int key_press(unsigned key) +{ + switch(key) { + case XK_Right: + x_pos +=1; + break; + case XK_Left: + x_pos -=1; + break; + case XK_Up: + y_pos +=1; + break; + case XK_Down: + y_pos -=1; + break; + case 'a': + img_width -= 5; + img_height -= 5; + break; + case 's': + img_width += 5; + img_height += 5; + break; + default: + break; + } + fprintf(stderr, "Posi = %dx%d\n", x_pos, y_pos); + fprintf(stderr, "Size = %dx%d\n", img_width, img_height); + return VG_FALSE; +} + +static void +draw(void) +{ + VGint WINDSIZEX = window_width(); + VGint WINDSIZEY = window_height(); + + VGPaint fill; + VGPath box; + VGfloat color[4] = {1.f, 0.f, 0.f, 1.f}; + VGfloat bgCol[4] = {0.7f, 0.7f, 0.7f, 1.0f}; + VGfloat transCol[4] = {0.f, 0.f, 0.f, 0.f}; + VGImage image = vgCreateImage(VG_sRGBA_8888, img_width, img_height, + VG_IMAGE_QUALITY_NONANTIALIASED); + + /* Background clear */ + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + box = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + /* Rectangle to cover completely 16x16 pixel area. */ + RectToPath(box, 0, 0, 64, 64); + + vgSetfv(VG_CLEAR_COLOR, 4, transCol); + vgClearImage(image, 0, 0, img_width, img_height); + vgSetfv(VG_CLEAR_COLOR, 4, color); + vgClearImage(image, 10, 10, 12, 12); + //vgImageSubData(image, pukki_64x64_data, pukki_64x64_stride, + // VG_sRGBA_8888, 0, 0, 32, 32); + vgSeti(VG_MASKING, VG_TRUE); + vgLoadIdentity(); + + vgSetfv(VG_CLEAR_COLOR, 4, bgCol); + vgClear(0, 0, WINDSIZEX, WINDSIZEY); + + + vgMask(image, VG_FILL_MASK, 0, 0, window_width(), window_height()); + vgMask(image, VG_SET_MASK, x_pos, y_pos, 100, 100); + + vgDrawPath(box, VG_FILL_PATH); + + //vgSeti(VG_MATRIX_MODE, VG_MATRIX_IMAGE_USER_TO_SURFACE); + //vgTranslate(-10, -10); + //vgDrawImage(image); + + + vgDestroyPaint(fill); + vgDestroyPath(box); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, key_press); +} diff --git a/progs/openvg/trivial/path3.c b/progs/openvg/trivial/path3.c new file mode 100644 index 0000000000..5ce600f65a --- /dev/null +++ b/progs/openvg/trivial/path3.c @@ -0,0 +1,77 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> +#include <VG/vgu.h> +#include <stdio.h> +#include <math.h> +#include <stdlib.h> + +static void +init(void) +{ +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + + +static void +draw(void) +{ + VGint WINDSIZEX = window_width(); + VGint WINDSIZEY = window_height(); + VGPath path; + VGPaint paint; + + VGfloat clearColor[] = {1.0f, 1.0f, 1.0f, 0.0f};/* white color */ + VGfloat fillColor[] = {1.0f, 0.0f, 0.0f, 1.0f};/* red color */ + +#if 1 + VGubyte commands[4] = {VG_MOVE_TO_ABS, VG_LCWARC_TO_ABS, VG_SCWARC_TO_ABS, VG_CLOSE_PATH}; +#else + VGubyte commands[4] = {VG_MOVE_TO_ABS, VG_SCCWARC_TO_ABS, VG_LCCWARC_TO_ABS,VG_CLOSE_PATH}; +#endif + VGfloat coords[] = {32.0f, 0.0f, + -32.0f, -32.0f, 0.0f, 64.0f, 32.0f, + -32.0f, -32.0f, 0.0f, 32.0f, 0.0f}; + + + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + vgClear(0, 0, WINDSIZEX, WINDSIZEY); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + vgSeti(VG_MATRIX_MODE, VG_MATRIX_PATH_USER_TO_SURFACE); + vgLoadIdentity(); + //vgTranslate(32.0f, 32.0f); + + path = vgCreatePath( VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL ); + if ( path == VG_INVALID_HANDLE ) { + return; + } + paint = vgCreatePaint(); + if ( paint == VG_INVALID_HANDLE ) { + vgDestroyPath(path); + return; + } + + vgAppendPathData(path, 4, commands, coords); + vgSetParameterfv(paint, VG_PAINT_COLOR, 4, fillColor); + vgSetParameteri( paint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + vgSetPaint(paint, VG_FILL_PATH); + vgDrawPath(path, VG_FILL_PATH); + + vgDestroyPath(path); + vgDestroyPaint(paint); +} + + +int main(int argc, char **argv) +{ + set_window_size(64, 64); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/radialgrad.c b/progs/openvg/trivial/radialgrad.c new file mode 100644 index 0000000000..cf3b1d522d --- /dev/null +++ b/progs/openvg/trivial/radialgrad.c @@ -0,0 +1,99 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +#include <stdio.h> +#include <string.h> + +static const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; + +static VGPath path; +static VGPaint fill; + + +VGfloat centeredGradient[5] = {200.0f, 200.0f, 200.0f, 200.0f, 100}; +VGfloat noncenteredGradient[5] = {200.0f, 200.0f, 250.0f, 250.0f, 100}; +VGfloat *radialGradient = centeredGradient; + +VGColorRampSpreadMode spread = VG_COLOR_RAMP_SPREAD_PAD; + +static void +init(void) +{ + static const VGubyte sqrCmds[5] = {VG_MOVE_TO_ABS, VG_HLINE_TO_ABS, VG_VLINE_TO_ABS, VG_HLINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat sqrCoords[5] = {0.0f, 0.0f, 400.0f, 400.0f, 0.0f}; + + VGfloat rampStop[] = {0.00f, 1.0f, 1.0f, 1.0f, 1.0f, + 0.33f, 1.0f, 0.0f, 0.0f, 1.0f, + 0.66f, 0.0f, 1.0f, 0.0f, 1.0f, + 1.00f, 0.0f, 0.0f, 1.0f, 1.0f}; + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 5, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetParameteri(fill, VG_PAINT_TYPE, VG_PAINT_TYPE_RADIAL_GRADIENT); + vgSetParameteri(fill, VG_PAINT_COLOR_RAMP_SPREAD_MODE, spread); + vgSetParameterfv(fill, VG_PAINT_RADIAL_GRADIENT, 5, radialGradient); + vgSetParameterfv(fill, VG_PAINT_COLOR_RAMP_STOPS, 20, rampStop); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + + vgDrawPath(path, VG_FILL_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + VGint i; + for (i = 1; i < argc; ++i) { + const char *arg = argv[i]; + if (!strcmp("-pad", arg)) + spread = VG_COLOR_RAMP_SPREAD_PAD; + else if (!strcmp("-repeat", arg)) + spread = VG_COLOR_RAMP_SPREAD_REPEAT; + else if (!strcmp("-reflect", arg)) + spread = VG_COLOR_RAMP_SPREAD_REFLECT; + else if (!strcmp("-center", arg)) { + printf("Centered radial gradient\n"); + radialGradient = centeredGradient; + } else if (!strcmp("-noncenter", arg)) { + printf("Non centered radial gradient\n"); + radialGradient = noncenteredGradient; + } + } + + switch(spread) { + case VG_COLOR_RAMP_SPREAD_PAD: + printf("Using spread mode: pad\n"); + break; + case VG_COLOR_RAMP_SPREAD_REPEAT: + printf("Using spread mode: repeat\n"); + break; + case VG_COLOR_RAMP_SPREAD_REFLECT: + printf("Using spread mode: reflect\n"); + } + + set_window_size(400, 400); + + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/readpixels.c b/progs/openvg/trivial/readpixels.c new file mode 100644 index 0000000000..c8e286db9a --- /dev/null +++ b/progs/openvg/trivial/readpixels.c @@ -0,0 +1,75 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +#include <stdio.h> +#include <stdlib.h> +#include <string.h> +#include <assert.h> + +float red_color[4] = {1.0, 0.0, 0.0, 1.0}; +float blue_color[4] = {0.0, 0.0, 1.0, 1.0}; +VGint *data; + +static void +init(void) +{ + data = malloc(sizeof(VGint)*2048*2048); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + static const VGint red_pixel = 255 << 24 | 255 << 16 | 0 << 8 | 0; + static const VGint blue_pixel = 255 << 24 | 0 << 16 | 0 << 8 | 255; + VGint i; + + vgSetfv(VG_CLEAR_COLOR, 4, red_color); + vgClear(0, 0, window_width(), window_height()); + vgFlush(); + + memset(data, 0, window_width() * window_height() * sizeof(VGint)); + + vgReadPixels(data, window_width() * sizeof(VGint), + VG_lARGB_8888, + 0, 0, window_width(), window_height()); + + fprintf(stderr, "Red 0 = 0x%x and at 600 = 0x%x\n", + data[0], data[600]); + for (i = 0; i < window_width() * window_height(); ++i) { + assert(data[i] == red_pixel); + } + + vgSetfv(VG_CLEAR_COLOR, 4, blue_color); + vgClear(50, 50, 50, 50); + vgFlush(); + + memset(data, 0, window_width() * window_height() * sizeof(VGint)); + + vgReadPixels(data, 50 * sizeof(VGint), + VG_lARGB_8888, + 50, 50, 50, 50); + + fprintf(stderr, "Blue 0 = 0x%x and at 100 = 0x%x\n", + data[0], data[100]); + for (i = 0; i < 50 * 50; ++i) { + assert(data[i] == blue_pixel); + } +} + + +int main(int argc, char **argv) +{ + int ret = run(argc, argv, init, reshape, + draw, 0); + + free(data); + return ret; +} diff --git a/progs/openvg/trivial/roundedrect.c b/progs/openvg/trivial/roundedrect.c new file mode 100644 index 0000000000..c80a4ed299 --- /dev/null +++ b/progs/openvg/trivial/roundedrect.c @@ -0,0 +1,67 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.9, 0.1, 0.1, 0.8}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + static const VGubyte sqrCmds[10] = {VG_MOVE_TO_ABS, + VG_LINE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_LINE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_LINE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_LINE_TO_ABS, + VG_CUBIC_TO_ABS, + VG_CLOSE_PATH}; + static const VGfloat sqrCoords[] = { + 45.885571, 62.857143, + 154.11442, 62.857143, + 162.1236, 62.857143, 168.57142, 70.260744, 168.57142, 79.457144, + 168.57142, 123.4, + 168.57142, 132.5964, 162.1236, 140, 154.11442, 140, + 45.885571, 140, + 37.876394, 140, 31.428572, 132.5964, 31.428572, 123.4, + 31.428572, 79.457144, + 31.428572, 70.260744, 37.876394,62.857143, 45.885571,62.857143 + }; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 10, sqrCmds, sqrCoords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 6); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_STROKE_PATH); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/star-nonzero.c b/progs/openvg/trivial/star-nonzero.c new file mode 100644 index 0000000000..012fbd3929 --- /dev/null +++ b/progs/openvg/trivial/star-nonzero.c @@ -0,0 +1,55 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat green_color[4] = {0.0, 1.0, 0.0, 0.8}; + +VGPath path; +VGPaint fill; + + +static void +init(void) +{ + static const VGubyte cmds[6] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, + VG_LINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat coords[] = { 0, 200, + 300, 200, + 50, 0, + 150, 300, + 250, 0}; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 6, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, green_color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSeti(VG_FILL_RULE, VG_NON_ZERO); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_FILL_PATH | VG_STROKE_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/star-oddeven.c b/progs/openvg/trivial/star-oddeven.c new file mode 100644 index 0000000000..17311cf720 --- /dev/null +++ b/progs/openvg/trivial/star-oddeven.c @@ -0,0 +1,102 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat green_color[4] = {0.0, 1.0, 0.0, 0.8}; +const VGfloat black_color[4] = {0.0, 0.0, 0.0, 1.0}; + +VGPath path; +VGPaint fill; + + +static void draw_point(VGfloat x, VGfloat y) +{ + + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, + VG_LINE_TO_ABS, VG_CLOSE_PATH}; + const VGfloat coords[] = { x - 2, y - 2, + x + 2, y - 2, + x + 2, y + 2, + x - 2, y + 2}; + VGPath path; + VGPaint fill; + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_ALL); + vgAppendPathData(path, 5, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, black_color); + vgSetPaint(fill, VG_FILL_PATH); + + vgDrawPath(path, VG_FILL_PATH); + + vgDestroyPath(path); + vgDestroyPaint(fill); +} + +static void draw_marks(VGPath path) +{ + VGfloat point[2], tangent[2]; + int i = 0; + + for (i = 0; i < 1300; i += 50) { + vgPointAlongPath(path, 0, 6, i, + point + 0, point + 1, + tangent + 0, tangent + 1); + draw_point(point[0], point[1]); + } +} + +static void +init(void) +{ + static const VGubyte cmds[6] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, VG_LINE_TO_ABS, + VG_LINE_TO_ABS, VG_CLOSE_PATH}; + static const VGfloat coords[] = { 0, 200, + 300, 200, + 50, 0, + 150, 300, + 250, 0}; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_ALL); + vgAppendPathData(path, 6, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, green_color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + VGfloat point[2], tangent[2]; + int i = 0; + + vgClear(0, 0, window_width(), window_height()); + + vgSetPaint(fill, VG_FILL_PATH); + vgDrawPath(path, VG_FILL_PATH); + + draw_marks(path); + + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/progs/openvg/trivial/stroke.c b/progs/openvg/trivial/stroke.c new file mode 100644 index 0000000000..58ae5b7bc8 --- /dev/null +++ b/progs/openvg/trivial/stroke.c @@ -0,0 +1,116 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> +#include <X11/keysym.h> +#include <stdio.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint fill; + +VGint cap_style = VG_CAP_BUTT; +VGint join_style = VG_JOIN_MITER; + +static void +init(void) +{ +#if 0 + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_CUBIC_TO_ABS, + }; + static const VGfloat coords[] = {30, 30, 264, 0, 0, 264, 234, 234 + }; +#else + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_LINE_TO_ABS, + VG_LINE_TO_ABS + }; + static const VGfloat coords[] = {30, 30, 202, 30, 150, 224 + }; +#endif + VGfloat dash_pattern[2] = { 20.f, 20.f }; + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO); + vgAppendPathData(path, 3, cmds, coords); + + fill = vgCreatePaint(); + vgSetParameterfv(fill, VG_PAINT_COLOR, 4, color); + vgSetPaint(fill, VG_FILL_PATH); + + vgSetfv(VG_CLEAR_COLOR, 4, white_color); + vgSetf(VG_STROKE_LINE_WIDTH, 20); + vgSeti(VG_STROKE_CAP_STYLE, cap_style); + vgSeti(VG_STROKE_JOIN_STYLE, join_style); + vgSetfv(VG_STROKE_DASH_PATTERN, 2, dash_pattern); + vgSetf(VG_STROKE_DASH_PHASE, 0.0f); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_STROKE_PATH); + + vgFlush(); +} + +static int key_press(unsigned key) +{ + switch(key) { + case XK_c: + case XK_C: + ++cap_style; + if (cap_style > VG_CAP_SQUARE) + cap_style = VG_CAP_BUTT; + switch(cap_style) { + case VG_CAP_BUTT: + fprintf(stderr, "Cap style 'butt'\n"); + break; + case VG_CAP_ROUND: + fprintf(stderr, "Cap style 'round'\n"); + break; + case VG_CAP_SQUARE: + fprintf(stderr, "Cap style 'square'\n"); + break; + } + vgSeti(VG_STROKE_CAP_STYLE, cap_style); + break; + case XK_j: + case XK_J: + ++join_style; + if (join_style > VG_JOIN_BEVEL) + join_style = VG_JOIN_MITER; + switch(join_style) { + case VG_JOIN_MITER: + fprintf(stderr, "Join style 'miter'\n"); + break; + case VG_JOIN_ROUND: + fprintf(stderr, "Join style 'round'\n"); + break; + case VG_JOIN_BEVEL: + fprintf(stderr, "Join style 'bevel'\n"); + break; + } + vgSeti(VG_STROKE_JOIN_STYLE, join_style); + break; + default: + break; + } + + return VG_TRUE; +} + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, key_press); +} diff --git a/progs/openvg/trivial/stroke2.c b/progs/openvg/trivial/stroke2.c new file mode 100644 index 0000000000..ce950c1886 --- /dev/null +++ b/progs/openvg/trivial/stroke2.c @@ -0,0 +1,207 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> +#include <X11/keysym.h> +#include <stdio.h> + +VGPaint stroke; +VGPath target; +VGPath lines; + +VGfloat xform[9]; +VGfloat color1[4]; +VGfloat color2[4]; +VGfloat bgCol[4]; + +static void +init(void) +{ + VGubyte lineCmds[6]; + VGfloat lineCoords[8]; + VGfloat arcCoords[5]; + VGubyte sccCmd[1]; + VGubyte scCmd[1]; + VGubyte lccCmd[1]; + VGubyte lcCmd[1]; + VGubyte moveCmd[1]; + VGfloat moveCoords[2]; + VGint i; + + bgCol[0] = 1.0f; + bgCol[1] = 1.0f; + bgCol[2] = 1.0f; + bgCol[3] = 1.0f; + + vgSetfv(VG_CLEAR_COLOR, 4, bgCol); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + + stroke = vgCreatePaint(); + /* Red */ + color1[0] = 1.0f; + color1[1] = 0.0f; + color1[2] = 0.0f; + color1[3] = 1.0f; + + /* Orange */ + color2[0] = 1.0000f; + color2[1] = 1.0f; + color2[2] = 0.0f; + color2[3] = 1.0f; + vgSetPaint(stroke, VG_STROKE_PATH); + + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_SQUARE); + + { + VGfloat temp[9] = {0, 0, 0, 0, 0, 0, 0, 0, 0}; + for (i = 0; i < 9; i++) + { + xform[i] = temp[i]; + } + } + vgGetMatrix(xform); + + target = vgCreatePath(VG_PATH_FORMAT_STANDARD, + VG_PATH_DATATYPE_F, 1, 0, 0, 0, VG_PATH_CAPABILITY_TRANSFORM_TO); + +#if 0 + /* Line path */ + { + VGubyte temp[6] = {VG_MOVE_TO_ABS, VG_VLINE_TO_REL, + VG_MOVE_TO_ABS, VG_VLINE_TO_REL, + VG_HLINE_TO_REL, VG_VLINE_TO_REL}; + for (i = 0; i < 6; i++) + { + lineCmds[i] = temp[i]; + } + } + { + VGfloat temp[8] = {0.5f, 0.8f, -0.6f, 0.28f, 0.6f, -0.4f, 0.44f, 0.4f}; + for (i = 0; i < 8; i++) + { + lineCoords[i] = temp[i] * window_width(); + } + } +#else + { + VGfloat temp[5] = {0.35f, 0.15f, 29, 0.3f, 0.4f}; + for (i = 0; i < 5; i++) + { + arcCoords[i] = temp[i] * window_width(); + } + arcCoords[2] = 29; + } + + { + VGubyte temp[1] = {VG_SCCWARC_TO_ABS}; + for (i = 0; i < 1; i++) + { + sccCmd[i] = temp[i]; + } + } + { + VGubyte temp[1] = {VG_SCWARC_TO_ABS}; + for (i = 0; i < 1; i++) + { + scCmd[i] = temp[i]; + } + } + { + VGubyte temp[1] = {VG_LCCWARC_TO_ABS}; + for (i = 0; i < 1; i++) + { + lccCmd[i] = temp[i]; + } + } + { + VGubyte temp[1] = {VG_LCWARC_TO_ABS}; + for (i = 0; i < 1; i++) + { + lcCmd[i] = temp[i]; + } + } + + { + VGubyte temp[1] = {VG_MOVE_TO_ABS}; + for (i = 0; i < 1; i++) + { + moveCmd[i] = temp[i]; + } + } + { + VGfloat temp[2] = {0.7f, 0.6f}; + for (i = 0; i < 2; i++) + { + moveCoords[i] = temp[i] * window_width(); + } + } +#endif + + lines = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, 1, + 0, 0, 0, + VG_PATH_CAPABILITY_APPEND_TO| + VG_PATH_CAPABILITY_TRANSFORM_FROM); +#if 0 + vgAppendPathData(lines, 6, lineCmds, lineCoords); +#else + vgAppendPathData(lines, 1, moveCmd, moveCoords); + vgAppendPathData(lines, 1, sccCmd, arcCoords); + vgAppendPathData(lines, 1, moveCmd, moveCoords); + vgAppendPathData(lines, 1, scCmd, arcCoords); + vgAppendPathData(lines, 1, moveCmd, moveCoords); + vgAppendPathData(lines, 1, lccCmd, arcCoords); + vgAppendPathData(lines, 1, moveCmd, moveCoords); + vgAppendPathData(lines, 1, lcCmd, arcCoords); +#endif + + vgLoadIdentity(); + vgTranslate(0.25f * window_width(), 0.25f * window_height()); + vgRotate(30); + vgTranslate(-0.25f * window_width(), -0.25f * window_height()); + vgTransformPath(target, lines);} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgLoadMatrix(xform); + vgLoadIdentity(); + vgTranslate(0.25f * window_width(), 0.25f * window_height()); + vgRotate(30); + vgTranslate(-0.25f * window_width(), -0.25f * window_height()); + vgSetf(VG_STROKE_LINE_WIDTH, 7); + vgSetParameterfv(stroke, VG_PAINT_COLOR, 4, color1); + vgDrawPath(lines, VG_STROKE_PATH); + + vgLoadMatrix(xform); + vgSetParameterfv(stroke, VG_PAINT_COLOR, 4, color2); + vgSetf(VG_STROKE_LINE_WIDTH, 3); + vgDrawPath(target, VG_STROKE_PATH); +} + +static int key_press(unsigned key) +{ + switch(key) { + case XK_c: + case XK_C: + break; + case XK_j: + case XK_J: + break; + default: + break; + } + + return VG_TRUE; +} + +int main(int argc, char **argv) +{ + return run(argc, argv, init, reshape, + draw, key_press); +} diff --git a/progs/openvg/trivial/vguarc.c b/progs/openvg/trivial/vguarc.c new file mode 100644 index 0000000000..8d971d5c09 --- /dev/null +++ b/progs/openvg/trivial/vguarc.c @@ -0,0 +1,74 @@ +#include "eglcommon.h" + +#include <VG/openvg.h> +#include <VG/vgu.h> + +const VGfloat white_color[4] = {1.0, 1.0, 1.0, 1.0}; +const VGfloat color[4] = {0.4, 0.1, 1.0, 1.0}; + +VGPath path; +VGPaint paint; + + +static void +init(void) +{ + VGfloat clearColor[] = {0.0f, 0.0f, 0.0f, 1.0f};/* black color */ + VGfloat greenColor[] = {0.0f, 1.0f, 0.0f, 1.0f};/* green color */ + VGint arcType = VGU_ARC_OPEN; + VGfloat x, y, w, h, startAngle, angleExtent; + + x = 150; + y = 150; + w = 150; + h = 150; +#if 0 + startAngle = -540.0f; + angleExtent = 270.0f; +#else + startAngle = 270.0f; + angleExtent = 90.0f; +#endif + + paint = vgCreatePaint(); + + vgSetPaint(paint, VG_STROKE_PATH); + vgSetParameterfv(paint, VG_PAINT_COLOR, 4, greenColor); + vgSetParameteri( paint, VG_PAINT_TYPE, VG_PAINT_TYPE_COLOR); + vgSetf(VG_STROKE_LINE_WIDTH, 6.0f); + vgSeti(VG_RENDERING_QUALITY, VG_RENDERING_QUALITY_NONANTIALIASED); + vgSetfv(VG_CLEAR_COLOR, 4, clearColor); + + path = vgCreatePath(VG_PATH_FORMAT_STANDARD, VG_PATH_DATATYPE_F, + 1.0f, 0.0f, 0, 0, VG_PATH_CAPABILITY_ALL); + + vguArc(path, x, y, w, h, startAngle, angleExtent, arcType); + + vgSeti(VG_STROKE_CAP_STYLE, VG_CAP_BUTT); + vgSeti(VG_STROKE_JOIN_STYLE, VG_JOIN_BEVEL); + vgSetf(VG_STROKE_MITER_LIMIT, 4.0f); +} + +/* new window size or exposure */ +static void +reshape(int w, int h) +{ + vgLoadIdentity(); +} + +static void +draw(void) +{ + vgClear(0, 0, window_width(), window_height()); + vgDrawPath(path, VG_STROKE_PATH); + + vgFlush(); +} + + +int main(int argc, char **argv) +{ + // set_window_size(64, 63); + return run(argc, argv, init, reshape, + draw, 0); +} diff --git a/src/gallium/state_trackers/vega/Makefile b/src/gallium/state_trackers/vega/Makefile new file mode 100644 index 0000000000..b8c805b06c --- /dev/null +++ b/src/gallium/state_trackers/vega/Makefile @@ -0,0 +1,128 @@ +# src/mesa/Makefile + +TOP = ../../../.. +include $(TOP)/configs/current +GALLIUM = $(TOP) + +### Lists of source files, included by Makefiles + +VG_SOURCES = \ + api_context.c \ + api_filters.c \ + api_images.c \ + api_masks.c \ + api_misc.c \ + api_paint.c \ + api_params.c \ + api_path.c \ + api_text.c \ + api_transform.c \ + vgu.c \ + vg_context.c \ + vg_state.c \ + vg_tracker.c \ + vg_translate.c \ + polygon.c \ + bezier.c \ + path.c \ + paint.c \ + arc.c \ + image.c \ + renderer.c \ + stroker.c \ + mask.c \ + shader.c \ + shaders_cache.c + + +### All the core C sources + +ALL_SOURCES = \ + $(VG_SOURCES) + + +### Object files +VG_OBJECTS = \ + $(VG_SOURCES:.c=.o) + +### Include directories + +INCLUDE_DIRS = \ + -I$(TOP)/include \ + -I$(GALLIUM)/include \ + -I$(GALLIUM)/src/gallium/include \ + -I$(GALLIUM)/src/gallium/auxiliary + +VG_LIB = OpenVG +VG_LIB_NAME = lib$(VG_LIB).so + +VG_MAJOR = 1 +VG_MINOR = 0 +VG_TINY = 0 + +GALLIUM_LIBS = \ + $(GALLIUM)/src/gallium/auxiliary/pipebuffer/libpipebuffer.a \ + $(GALLIUM)/src/gallium/auxiliary/sct/libsct.a \ + $(GALLIUM)/src/gallium/auxiliary/draw/libdraw.a \ + $(GALLIUM)/src/gallium/auxiliary/rtasm/librtasm.a \ + $(GALLIUM)/src/gallium/auxiliary/translate/libtranslate.a \ + $(GALLIUM)/src/gallium/auxiliary/cso_cache/libcso_cache.a \ + $(GALLIUM)/src/gallium/auxiliary/util/libutil.a \ + $(GALLIUM)/src/gallium/auxiliary/tgsi/libtgsi.a + +.SUFFIXES : .cpp + +.c.o: + $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@ + +.cpp.o: + $(CXX) -c $(INCLUDE_DIRS) $(CXXFLAGS) $< -o $@ + +.S.o: + $(CC) -c $(INCLUDE_DIRS) $(CFLAGS) $< -o $@ + + +default: depend subdirs $(TOP)/$(LIB_DIR)/$(VG_LIB_NAME) + +# Make the OpenVG library +$(TOP)/$(LIB_DIR)/$(VG_LIB_NAME): $(VG_OBJECTS) $(GALLIUM_LIBS) + $(TOP)/bin/mklib -o $(VG_LIB) \ + -major $(VG_MAJOR) \ + -minor $(VG_MINOR) \ + -patch $(VG_TINY) \ + -install $(TOP)/$(LIB_DIR) \ + $(VG_OBJECTS) $(GALLIUM_LIBS) \ + -Wl,--whole-archive $(LIBS) -Wl,--no-whole-archive $(SYS_LIBS) + +###################################################################### +# Generic stuff + +depend: $(ALL_SOURCES) + @ echo "running $(MKDEP)" + @ rm -f depend # workaround oops on gutsy?!? + @ touch depend + @ $(MKDEP) $(MKDEP_OPTIONS) $(DEFINES) $(INCLUDE_DIRS) $(ALL_SOURCES) \ + > /dev/null 2>/dev/null + + +subdirs: + +install: default + $(INSTALL) -d $(INSTALL_DIR)/include/VG + $(INSTALL) -d $(INSTALL_DIR)/$(LIB_DIR) + $(INSTALL) -m 644 $(TOP)/include/VG/*.h $(INSTALL_DIR)/include/VG + @if [ -e $(TOP)/$(LIB_DIR)/$(VG_LIB_NAME) ]; then \ + $(INSTALL) $(TOP)/$(LIB_DIR)/libOpenVG* $(INSTALL_DIR)/$(LIB_DIR); \ + fi + +# Emacs tags +tags: + etags `find . -name \*.[ch]` $(TOP)/include/VG/*.h + +clean: + -rm -f *.o + -rm -f */*.o + -rm -f */*/*.o + -rm -f depend depend.bak + +include depend diff --git a/src/gallium/state_trackers/vega/api_consts.h b/src/gallium/state_trackers/vega/api_consts.h new file mode 100644 index 0000000000..e1b48d4a46 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_consts.h @@ -0,0 +1,56 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef API_CONSTS_H +#define API_CONSTS_H + +/*must be at least 32*/ +#define VEGA_MAX_SCISSOR_RECTS 32 + +/*must be at least 16*/ +#define VEGA_MAX_DASH_COUNT 32 + +/*must be at least 7*/ +#define VEGA_MAX_KERNEL_SIZE 7 + +/*must be at least 15*/ +#define VEGA_MAX_SEPARABLE_KERNEL_SIZE 15 + +/*must be at least 32*/ +#define VEGA_MAX_COLOR_RAMP_STOPS 256 + +#define VEGA_MAX_IMAGE_WIDTH 2048 + +#define VEGA_MAX_IMAGE_HEIGHT 2048 + +#define VEGA_MAX_IMAGE_PIXELS (2048*2048) + +#define VEGA_MAX_IMAGE_BYTES (2048*2048 * 4) + +/*must be at least 128*/ +#define VEGA_MAX_GAUSSIAN_STD_DEVIATION 128 + +#endif diff --git a/src/gallium/state_trackers/vega/api_context.c b/src/gallium/state_trackers/vega/api_context.c new file mode 100644 index 0000000000..47db102dd2 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_context.c @@ -0,0 +1,75 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" + +VGErrorCode vgGetError(void) +{ + struct vg_context *ctx = vg_current_context(); + VGErrorCode error = VG_NO_CONTEXT_ERROR; + + if (!ctx) + return error; + + error = ctx->_error; + ctx->_error = VG_NO_ERROR; + + return error; +} + +void vgFlush(void) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe; + + if (!ctx) + return; + + pipe = ctx->pipe; + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); +} + +void vgFinish(void) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_fence_handle *fence = NULL; + struct pipe_context *pipe; + + if (!ctx) + return; + + pipe = ctx->pipe; + + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE | PIPE_FLUSH_FRAME, &fence); + + pipe->screen->fence_finish(pipe->screen, fence, 0); + pipe->screen->fence_reference(pipe->screen, &fence, NULL); +} diff --git a/src/gallium/state_trackers/vega/api_filters.c b/src/gallium/state_trackers/vega/api_filters.c new file mode 100644 index 0000000000..862cbb03c4 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_filters.c @@ -0,0 +1,805 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "image.h" +#include "renderer.h" +#include "shaders_cache.h" +#include "st_inlines.h" + +#include "pipe/p_context.h" +#include "pipe/p_state.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" +#include "pipe/p_shader_tokens.h" + +#include "util/u_memory.h" + + +#include "asm_filters.h" + + +struct filter_info { + struct vg_image *dst; + struct vg_image *src; + struct vg_shader * (*setup_shader)(struct vg_context *, void *); + void *user_data; + const void *const_buffer; + VGint const_buffer_len; + VGTilingMode tiling_mode; + struct pipe_texture *extra_texture; +}; + +static INLINE struct pipe_texture *create_texture_1d(struct vg_context *ctx, + const VGuint *color_data, + const VGint color_data_len) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_texture *tex = 0; + struct pipe_texture templ; + + memset(&templ, 0, sizeof(templ)); + templ.target = PIPE_TEXTURE_1D; + templ.format = PIPE_FORMAT_A8R8G8B8_UNORM; + templ.last_level = 0; + templ.width[0] = color_data_len; + templ.height[0] = 1; + templ.depth[0] = 1; + pf_get_block(PIPE_FORMAT_A8R8G8B8_UNORM, &templ.block); + templ.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER; + + tex = screen->texture_create(screen, &templ); + + { /* upload color_data */ + struct pipe_transfer *transfer = + screen->get_tex_transfer(screen, tex, + 0, 0, 0, + PIPE_TRANSFER_READ_WRITE , + 0, 0, tex->width[0], tex->height[0]); + void *map = screen->transfer_map(screen, transfer); + memcpy(map, color_data, sizeof(VGint)*color_data_len); + screen->transfer_unmap(screen, transfer); + screen->tex_transfer_destroy(transfer); + } + + return tex; +} + +static INLINE struct pipe_surface * setup_framebuffer(struct vg_image *dst) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_framebuffer_state fb; + struct pipe_surface *dst_surf = pipe->screen->get_tex_surface( + pipe->screen, dst->texture, 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + /* drawing dest */ + memset(&fb, 0, sizeof(fb)); + fb.width = dst->x + dst_surf->width; + fb.height = dst->y + dst_surf->height; + fb.nr_cbufs = 1; + fb.cbufs[0] = dst_surf; + { + VGint i; + for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i) + fb.cbufs[i] = 0; + } + cso_set_framebuffer(ctx->cso_context, &fb); + + return dst_surf; +} + +static void setup_viewport(struct vg_image *dst) +{ + struct vg_context *ctx = vg_current_context(); + vg_set_viewport(ctx, VEGA_Y0_TOP); +} + +static void setup_blend() +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_blend_state blend; + memset(&blend, 0, sizeof(blend)); + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + if (ctx->state.vg.filter_channel_mask & VG_RED) + blend.colormask |= PIPE_MASK_R; + if (ctx->state.vg.filter_channel_mask & VG_GREEN) + blend.colormask |= PIPE_MASK_G; + if (ctx->state.vg.filter_channel_mask & VG_BLUE) + blend.colormask |= PIPE_MASK_B; + if (ctx->state.vg.filter_channel_mask & VG_ALPHA) + blend.colormask |= PIPE_MASK_A; + blend.blend_enable = 1; + cso_set_blend(ctx->cso_context, &blend); +} + +static void setup_constant_buffer(struct vg_context *ctx, const void *buffer, + VGint param_bytes) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_constant_buffer *cbuf = &ctx->filter.buffer; + + /* We always need to get a new buffer, to keep the drivers simple and + * avoid gratuitous rendering synchronization. */ + pipe_buffer_reference(&cbuf->buffer, NULL); + + cbuf->buffer = pipe_buffer_create(pipe->screen, 16, + PIPE_BUFFER_USAGE_CONSTANT, + param_bytes); + + if (cbuf->buffer) { + st_no_flush_pipe_buffer_write(ctx, cbuf->buffer, + 0, param_bytes, buffer); + } + + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf); +} + +static void setup_samplers(struct vg_context *ctx, struct filter_info *info) +{ + struct pipe_sampler_state *samplers[PIPE_MAX_SAMPLERS]; + struct pipe_texture *textures[PIPE_MAX_SAMPLERS]; + struct pipe_sampler_state sampler[3]; + int num_samplers = 0; + int num_textures = 0; + + samplers[0] = NULL; + samplers[1] = NULL; + samplers[2] = NULL; + samplers[3] = NULL; + textures[0] = NULL; + textures[1] = NULL; + textures[2] = NULL; + textures[3] = NULL; + + memset(&sampler[0], 0, sizeof(struct pipe_sampler_state)); + sampler[0].wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler[0].wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler[0].wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler[0].min_img_filter = PIPE_TEX_MIPFILTER_LINEAR; + sampler[0].mag_img_filter = PIPE_TEX_MIPFILTER_LINEAR; + sampler[0].normalized_coords = 1; + + switch(info->tiling_mode) { + case VG_TILE_FILL: + sampler[0].wrap_s = PIPE_TEX_WRAP_CLAMP_TO_BORDER; + sampler[0].wrap_t = PIPE_TEX_WRAP_CLAMP_TO_BORDER; + memcpy(sampler[0].border_color, + ctx->state.vg.tile_fill_color, + sizeof(VGfloat) * 4); + break; + case VG_TILE_PAD: + sampler[0].wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler[0].wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + break; + case VG_TILE_REPEAT: + sampler[0].wrap_s = PIPE_TEX_WRAP_REPEAT; + sampler[0].wrap_t = PIPE_TEX_WRAP_REPEAT; + break; + case VG_TILE_REFLECT: + sampler[0].wrap_s = PIPE_TEX_WRAP_MIRROR_REPEAT; + sampler[0].wrap_t = PIPE_TEX_WRAP_MIRROR_REPEAT; + break; + default: + debug_assert(!"Unknown tiling mode"); + } + + samplers[0] = &sampler[0]; + textures[0] = info->src->texture; + ++num_samplers; + ++num_textures; + + if (info->extra_texture) { + memcpy(&sampler[1], &sampler[0], sizeof(struct pipe_sampler_state)); + samplers[1] = &sampler[1]; + textures[1] = info->extra_texture; + ++num_samplers; + ++num_textures; + } + + + cso_set_samplers(ctx->cso_context, num_samplers, (const struct pipe_sampler_state **)samplers); + cso_set_sampler_textures(ctx->cso_context, num_textures, textures); +} + +static struct vg_shader * setup_color_matrix(struct vg_context *ctx, void *user_data) +{ + struct vg_shader *shader = + shader_create_from_text(ctx->pipe, color_matrix_asm, 200, + PIPE_SHADER_FRAGMENT); + cso_set_fragment_shader_handle(ctx->cso_context, shader->driver); + return shader; +} + +static struct vg_shader * setup_convolution(struct vg_context *ctx, void *user_data) +{ + char buffer[1024]; + VGint num_consts = (VGint)(long)(user_data); + struct vg_shader *shader; + + snprintf(buffer, 1023, convolution_asm, num_consts, num_consts / 2 + 1); + + shader = shader_create_from_text(ctx->pipe, buffer, 200, + PIPE_SHADER_FRAGMENT); + + cso_set_fragment_shader_handle(ctx->cso_context, shader->driver); + return shader; +} + +static struct vg_shader * setup_lookup(struct vg_context *ctx, void *user_data) +{ + struct vg_shader *shader = + shader_create_from_text(ctx->pipe, lookup_asm, + 200, PIPE_SHADER_FRAGMENT); + + cso_set_fragment_shader_handle(ctx->cso_context, shader->driver); + return shader; +} + + +static struct vg_shader * setup_lookup_single(struct vg_context *ctx, void *user_data) +{ + char buffer[1024]; + VGImageChannel channel = (VGImageChannel)(user_data); + struct vg_shader *shader; + + switch(channel) { + case VG_RED: + snprintf(buffer, 1023, lookup_single_asm, "xxxx"); + break; + case VG_GREEN: + snprintf(buffer, 1023, lookup_single_asm, "yyyy"); + break; + case VG_BLUE: + snprintf(buffer, 1023, lookup_single_asm, "zzzz"); + break; + case VG_ALPHA: + snprintf(buffer, 1023, lookup_single_asm, "wwww"); + break; + default: + debug_assert(!"Unknown color channel"); + } + + shader = shader_create_from_text(ctx->pipe, buffer, 200, + PIPE_SHADER_FRAGMENT); + + cso_set_fragment_shader_handle(ctx->cso_context, shader->driver); + return shader; +} + +static void execute_filter(struct vg_context *ctx, + struct filter_info *info) +{ + struct pipe_surface *dst_surf; + struct vg_shader *shader; + + cso_save_framebuffer(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + cso_save_viewport(ctx->cso_context); + cso_save_blend(ctx->cso_context); + cso_save_samplers(ctx->cso_context); + cso_save_sampler_textures(ctx->cso_context); + + dst_surf = setup_framebuffer(info->dst); + setup_viewport(info->dst); + setup_blend(); + setup_constant_buffer(ctx, info->const_buffer, info->const_buffer_len); + shader = info->setup_shader(ctx, info->user_data); + setup_samplers(ctx, info); + + renderer_draw_texture(ctx->renderer, + info->src->texture, + info->dst->x, info->dst->y, + info->dst->x + info->dst->width, + info->dst->y + info->dst->height, + info->dst->x, info->dst->y, + info->dst->x + info->dst->width, + info->dst->y + info->dst->height); + + cso_restore_framebuffer(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + cso_restore_viewport(ctx->cso_context); + cso_restore_blend(ctx->cso_context); + cso_restore_samplers(ctx->cso_context); + cso_restore_sampler_textures(ctx->cso_context); + + vg_shader_destroy(ctx, shader); + + pipe_surface_reference(&dst_surf, NULL); +} + +void vgColorMatrix(VGImage dst, VGImage src, + const VGfloat * matrix) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *d, *s; + struct filter_info info; + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!matrix || !is_aligned(matrix)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + info.dst = d; + info.src = s; + info.setup_shader = &setup_color_matrix; + info.user_data = NULL; + info.const_buffer = matrix; + info.const_buffer_len = 20 * sizeof(VGfloat); + info.tiling_mode = VG_TILE_PAD; + info.extra_texture = 0; + execute_filter(ctx, &info); +} + +static VGfloat texture_offset(VGfloat width, VGint kernelSize, VGint current, VGint shift) +{ + VGfloat diff = current - shift; + + return diff / width; +} + +void vgConvolve(VGImage dst, VGImage src, + VGint kernelWidth, VGint kernelHeight, + VGint shiftX, VGint shiftY, + const VGshort * kernel, + VGfloat scale, + VGfloat bias, + VGTilingMode tilingMode) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat *buffer; + VGint buffer_len; + VGint i, j; + VGint idx = 0; + struct vg_image *d, *s; + VGint kernel_size = kernelWidth * kernelHeight; + struct filter_info info; + const VGint max_kernel_size = vgGeti(VG_MAX_KERNEL_SIZE); + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (kernelWidth <= 0 || kernelHeight <= 0 || + kernelWidth > max_kernel_size || kernelHeight > max_kernel_size) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!kernel || !is_aligned_to(kernel, 2)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (tilingMode < VG_TILE_FILL || + tilingMode > VG_TILE_REFLECT) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + vg_validate_state(ctx); + + buffer_len = 8 + 2 * 4 * kernel_size; + buffer = (VGfloat*)malloc(buffer_len * sizeof(VGfloat)); + + buffer[0] = 0.f; + buffer[1] = 1.f; + buffer[2] = 2.f; /*unused*/ + buffer[3] = 4.f; /*unused*/ + + buffer[4] = kernelWidth * kernelHeight; + buffer[5] = scale; + buffer[6] = bias; + buffer[7] = 0.f; + + idx = 8; + for (j = 0; j < kernelHeight; ++j) { + for (i = 0; i < kernelWidth; ++i) { + VGint index = j * kernelWidth + i; + VGfloat x, y; + + x = texture_offset(s->width, kernelWidth, i, shiftX); + y = texture_offset(s->height, kernelHeight, j, shiftY); + + buffer[idx + index*4 + 0] = x; + buffer[idx + index*4 + 1] = y; + buffer[idx + index*4 + 2] = 0.f; + buffer[idx + index*4 + 3] = 0.f; + } + } + idx += kernel_size * 4; + + for (j = 0; j < kernelHeight; ++j) { + for (i = 0; i < kernelWidth; ++i) { + /* transpose the kernel */ + VGint index = j * kernelWidth + i; + VGint kindex = (kernelWidth - i - 1) * kernelHeight + (kernelHeight - j - 1); + buffer[idx + index*4 + 0] = kernel[kindex]; + buffer[idx + index*4 + 1] = kernel[kindex]; + buffer[idx + index*4 + 2] = kernel[kindex]; + buffer[idx + index*4 + 3] = kernel[kindex]; + } + } + + info.dst = d; + info.src = s; + info.setup_shader = &setup_convolution; + info.user_data = (void*)(long)(buffer_len/4); + info.const_buffer = buffer; + info.const_buffer_len = buffer_len * sizeof(VGfloat); + info.tiling_mode = tilingMode; + info.extra_texture = 0; + execute_filter(ctx, &info); + + free(buffer); +} + +void vgSeparableConvolve(VGImage dst, VGImage src, + VGint kernelWidth, + VGint kernelHeight, + VGint shiftX, VGint shiftY, + const VGshort * kernelX, + const VGshort * kernelY, + VGfloat scale, + VGfloat bias, + VGTilingMode tilingMode) +{ + struct vg_context *ctx = vg_current_context(); + VGshort *kernel; + VGint i, j, idx = 0; + const VGint max_kernel_size = vgGeti(VG_MAX_SEPARABLE_KERNEL_SIZE); + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (kernelWidth <= 0 || kernelHeight <= 0 || + kernelWidth > max_kernel_size || kernelHeight > max_kernel_size) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!kernelX || !kernelY || + !is_aligned_to(kernelX, 2) || !is_aligned_to(kernelY, 2)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (tilingMode < VG_TILE_FILL || + tilingMode > VG_TILE_REFLECT) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + kernel = malloc(sizeof(VGshort)*kernelWidth*kernelHeight); + for (i = 0; i < kernelWidth; ++i) { + for (j = 0; j < kernelHeight; ++j) { + kernel[idx] = kernelX[i] * kernelY[j]; + ++idx; + } + } + vgConvolve(dst, src, kernelWidth, kernelHeight, shiftX, shiftY, + kernel, scale, bias, tilingMode); + free(kernel); +} + +static INLINE VGfloat compute_gaussian_componenet(VGfloat x, VGfloat y, + VGfloat stdDeviationX, + VGfloat stdDeviationY) +{ + VGfloat mult = 1 / ( 2 * M_PI * stdDeviationX * stdDeviationY); + VGfloat e = exp( - ( pow(x, 2)/(2*pow(stdDeviationX, 2)) + + pow(y, 2)/(2*pow(stdDeviationY, 2)) ) ); + return mult * e; +} + +static INLINE VGint compute_kernel_size(VGfloat deviation) +{ + VGint size = ceil(2.146 * deviation); + if (size > 11) + return 11; + return size; +} + +static void compute_gaussian_kernel(VGfloat *kernel, + VGint width, VGint height, + VGfloat stdDeviationX, + VGfloat stdDeviationY) +{ + VGint i, j; + VGfloat scale = 0.0f; + + for (j = 0; j < height; ++j) { + for (i = 0; i < width; ++i) { + VGint idx = (height - j -1) * width + (width - i -1); + kernel[idx] = compute_gaussian_componenet(i-(ceil(width/2))-1, + j-ceil(height/2)-1, + stdDeviationX, stdDeviationY); + scale += kernel[idx]; + } + } + + for (j = 0; j < height; ++j) { + for (i = 0; i < width; ++i) { + VGint idx = j * width + i; + kernel[idx] /= scale; + } + } +} + +void vgGaussianBlur(VGImage dst, VGImage src, + VGfloat stdDeviationX, + VGfloat stdDeviationY, + VGTilingMode tilingMode) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *d, *s; + VGfloat *buffer, *kernel; + VGint kernel_width, kernel_height, kernel_size; + VGint buffer_len; + VGint idx, i, j; + struct filter_info info; + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (stdDeviationX <= 0 || stdDeviationY <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (tilingMode < VG_TILE_FILL || + tilingMode > VG_TILE_REFLECT) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + kernel_width = compute_kernel_size(stdDeviationX); + kernel_height = compute_kernel_size(stdDeviationY); + kernel_size = kernel_width * kernel_height; + kernel = malloc(sizeof(VGfloat)*kernel_size); + compute_gaussian_kernel(kernel, kernel_width, kernel_height, + stdDeviationX, stdDeviationY); + + buffer_len = 8 + 2 * 4 * kernel_size; + buffer = (VGfloat*)malloc(buffer_len * sizeof(VGfloat)); + + buffer[0] = 0.f; + buffer[1] = 1.f; + buffer[2] = 2.f; /*unused*/ + buffer[3] = 4.f; /*unused*/ + + buffer[4] = kernel_width * kernel_height; + buffer[5] = 1.f;/*scale*/ + buffer[6] = 0.f;/*bias*/ + buffer[7] = 0.f; + + idx = 8; + for (j = 0; j < kernel_height; ++j) { + for (i = 0; i < kernel_width; ++i) { + VGint index = j * kernel_width + i; + VGfloat x, y; + + x = texture_offset(s->width, kernel_width, i, kernel_width/2); + y = texture_offset(s->height, kernel_height, j, kernel_height/2); + + buffer[idx + index*4 + 0] = x; + buffer[idx + index*4 + 1] = y; + buffer[idx + index*4 + 2] = 0.f; + buffer[idx + index*4 + 3] = 0.f; + } + } + idx += kernel_size * 4; + + for (j = 0; j < kernel_height; ++j) { + for (i = 0; i < kernel_width; ++i) { + /* transpose the kernel */ + VGint index = j * kernel_width + i; + VGint kindex = (kernel_width - i - 1) * kernel_height + (kernel_height - j - 1); + buffer[idx + index*4 + 0] = kernel[kindex]; + buffer[idx + index*4 + 1] = kernel[kindex]; + buffer[idx + index*4 + 2] = kernel[kindex]; + buffer[idx + index*4 + 3] = kernel[kindex]; + } + } + + info.dst = d; + info.src = s; + info.setup_shader = &setup_convolution; + info.user_data = (void*)(long)(buffer_len/4); + info.const_buffer = buffer; + info.const_buffer_len = buffer_len * sizeof(VGfloat); + info.tiling_mode = tilingMode; + info.extra_texture = 0; + execute_filter(ctx, &info); + + free(buffer); + free(kernel); +} + +void vgLookup(VGImage dst, VGImage src, + const VGubyte * redLUT, + const VGubyte * greenLUT, + const VGubyte * blueLUT, + const VGubyte * alphaLUT, + VGboolean outputLinear, + VGboolean outputPremultiplied) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *d, *s; + VGuint color_data[256]; + VGint i; + struct pipe_texture *lut_texture; + VGfloat buffer[4]; + struct filter_info info; + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!redLUT || !greenLUT || !blueLUT || !alphaLUT) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + for (i = 0; i < 256; ++i) { + color_data[i] = blueLUT[i] << 24 | greenLUT[i] << 16 | + redLUT[i] << 8 | alphaLUT[i]; + } + lut_texture = create_texture_1d(ctx, color_data, 255); + + buffer[0] = 0.f; + buffer[1] = 0.f; + buffer[2] = 1.f; + buffer[3] = 1.f; + + info.dst = d; + info.src = s; + info.setup_shader = &setup_lookup; + info.user_data = NULL; + info.const_buffer = buffer; + info.const_buffer_len = 4 * sizeof(VGfloat); + info.tiling_mode = VG_TILE_PAD; + info.extra_texture = lut_texture; + + execute_filter(ctx, &info); + + pipe_texture_reference(&lut_texture, NULL); +} + +void vgLookupSingle(VGImage dst, VGImage src, + const VGuint * lookupTable, + VGImageChannel sourceChannel, + VGboolean outputLinear, + VGboolean outputPremultiplied) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *d, *s; + struct pipe_texture *lut_texture; + VGfloat buffer[4]; + struct filter_info info; + VGuint color_data[256]; + VGint i; + + if (dst == VG_INVALID_HANDLE || src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!lookupTable || !is_aligned(lookupTable)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (sourceChannel != VG_RED && sourceChannel != VG_GREEN && + sourceChannel != VG_BLUE && sourceChannel != VG_ALPHA) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + d = (struct vg_image*)dst; + s = (struct vg_image*)src; + + if (vg_image_overlaps(d, s)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + for (i = 0; i < 256; ++i) { + VGuint rgba = lookupTable[i]; + VGubyte blue, green, red, alpha; + red = (rgba & 0xff000000)>>24; + green = (rgba & 0x00ff0000)>>16; + blue = (rgba & 0x0000ff00)>> 8; + alpha = (rgba & 0x000000ff)>> 0; + color_data[i] = blue << 24 | green << 16 | + red << 8 | alpha; + } + lut_texture = create_texture_1d(ctx, color_data, 256); + + buffer[0] = 0.f; + buffer[1] = 0.f; + buffer[2] = 1.f; + buffer[3] = 1.f; + + info.dst = d; + info.src = s; + info.setup_shader = &setup_lookup_single; + info.user_data = (void*)sourceChannel; + info.const_buffer = buffer; + info.const_buffer_len = 4 * sizeof(VGfloat); + info.tiling_mode = VG_TILE_PAD; + info.extra_texture = lut_texture; + + execute_filter(ctx, &info); + + pipe_texture_reference(&lut_texture, NULL); +} diff --git a/src/gallium/state_trackers/vega/api_images.c b/src/gallium/state_trackers/vega/api_images.c new file mode 100644 index 0000000000..c437553bc2 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_images.c @@ -0,0 +1,489 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "image.h" + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "vg_translate.h" +#include "api_consts.h" +#include "image.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_inlines.h" +#include "util/u_blit.h" +#include "util/u_tile.h" +#include "util/u_memory.h" + +static INLINE VGboolean supported_image_format(VGImageFormat format) +{ + switch(format) { + case VG_sRGBX_8888: + case VG_sRGBA_8888: + case VG_sRGBA_8888_PRE: + case VG_sRGB_565: + case VG_sRGBA_5551: + case VG_sRGBA_4444: + case VG_sL_8: + case VG_lRGBX_8888: + case VG_lRGBA_8888: + case VG_lRGBA_8888_PRE: + case VG_lL_8: + case VG_A_8: + case VG_BW_1: +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: + case VG_A_4: +#endif + case VG_sXRGB_8888: + case VG_sARGB_8888: + case VG_sARGB_8888_PRE: + case VG_sARGB_1555: + case VG_sARGB_4444: + case VG_lXRGB_8888: + case VG_lARGB_8888: + case VG_lARGB_8888_PRE: + case VG_sBGRX_8888: + case VG_sBGRA_8888: + case VG_sBGRA_8888_PRE: + case VG_sBGR_565: + case VG_sBGRA_5551: + case VG_sBGRA_4444: + case VG_lBGRX_8888: + case VG_lBGRA_8888: + case VG_lBGRA_8888_PRE: + case VG_sXBGR_8888: + case VG_sABGR_8888: + case VG_sABGR_8888_PRE: + case VG_sABGR_1555: + case VG_sABGR_4444: + case VG_lXBGR_8888: + case VG_lABGR_8888: + case VG_lABGR_8888_PRE: + return VG_TRUE; + default: + return VG_FALSE; + } + return VG_FALSE; +} + +VGImage vgCreateImage(VGImageFormat format, + VGint width, VGint height, + VGbitfield allowedQuality) +{ + struct vg_context *ctx = vg_current_context(); + + if (!supported_image_format(format)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return VG_INVALID_HANDLE; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + if (width > vgGeti(VG_MAX_IMAGE_WIDTH) || + height > vgGeti(VG_MAX_IMAGE_HEIGHT)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + if (width * height > vgGeti(VG_MAX_IMAGE_PIXELS)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + if (!(allowedQuality & ((VG_IMAGE_QUALITY_NONANTIALIASED | + VG_IMAGE_QUALITY_FASTER | + VG_IMAGE_QUALITY_BETTER)))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + return (VGImage)image_create(format, width, height); +} + +void vgDestroyImage(VGImage image) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img = (struct vg_image *)image; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!vg_object_is_valid((void*)image, VG_OBJECT_IMAGE)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + image_destroy(img); +} + +void vgClearImage(VGImage image, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + img = (struct vg_image*)image; + + if (x + width < 0 || y + height < 0) + return; + + image_clear(img, x, y, width, height); + +} + +void vgImageSubData(VGImage image, + const void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!supported_image_format(dataFormat)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return; + } + if (width <= 0 || height <= 0 || !data || !is_aligned(data)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + img = (struct vg_image*)(image); + image_sub_data(img, data, dataStride, dataFormat, + x, y, width, height); +} + +void vgGetImageSubData(VGImage image, + void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!supported_image_format(dataFormat)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return; + } + if (width <= 0 || height <= 0 || !data || !is_aligned(data)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + img = (struct vg_image*)image; + image_get_sub_data(img, data, dataStride, dataFormat, + x, y, width, height); +} + +VGImage vgChildImage(VGImage parent, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *p; + + if (parent == VG_INVALID_HANDLE || + !vg_context_is_object_valid(ctx, VG_OBJECT_IMAGE, (void*)parent) || + !vg_object_is_valid((void*)parent, VG_OBJECT_IMAGE)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return VG_INVALID_HANDLE; + } + if (width <= 0 || height <= 0 || x < 0 || y < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + p = (struct vg_image *)parent; + if (x > p->width || y > p->height) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + if (x + width > p->width || y + height > p->height) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + return (VGImage)image_child_image(p, x, y, width, height); +} + +VGImage vgGetParent(VGImage image) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return VG_INVALID_HANDLE; + } + + img = (struct vg_image*)image; + if (img->parent) + return (VGImage)img->parent; + else + return image; +} + +void vgCopyImage(VGImage dst, VGint dx, VGint dy, + VGImage src, VGint sx, VGint sy, + VGint width, VGint height, + VGboolean dither) +{ + struct vg_context *ctx = vg_current_context(); + + if (src == VG_INVALID_HANDLE || dst == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + vg_validate_state(ctx); + image_copy((struct vg_image*)dst, dx, dy, + (struct vg_image*)src, sx, sy, + width, height, dither); +} + +void vgDrawImage(VGImage image) +{ + struct vg_context *ctx = vg_current_context(); + + if (!ctx) + return; + + if (image == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + vg_validate_state(ctx); + image_draw((struct vg_image*)image); +} + +void vgSetPixels(VGint dx, VGint dy, + VGImage src, VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + + vg_validate_state(ctx); + + if (src == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + image_set_pixels(dx, dy, (struct vg_image*)src, sx, sy, width, + height); +} + +void vgGetPixels(VGImage dst, VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *img; + + if (dst == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + img = (struct vg_image*)dst; + + image_get_pixels(img, dx, dy, + sx, sy, width, height); +} + +void vgWritePixels(const void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint dx, VGint dy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + + if (!supported_image_format(dataFormat)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return; + } + if (!data || !is_aligned(data)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + vg_validate_state(ctx); + { + struct vg_image *img = image_create(dataFormat, width, height); + image_sub_data(img, data, dataStride, dataFormat, 0, 0, + width, height); +#if 0 + struct matrix *matrix = &ctx->state.vg.image_user_to_surface_matrix; + matrix_translate(matrix, dx, dy); + image_draw(img); + matrix_translate(matrix, -dx, -dy); +#else + /* this looks like a better approach */ + image_set_pixels(dx, dy, img, 0, 0, width, height); +#endif + image_destroy(img); + } + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); +} + +void vgReadPixels(void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + + struct st_framebuffer *stfb = ctx->draw_buffer; + struct st_renderbuffer *strb = stfb->strb; + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + + VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4]; + VGfloat *df = (VGfloat*)temp; + VGint y = (fb->height - sy) - 1, yStep = -1; + VGint i; + VGubyte *dst = (VGubyte *)data; + VGint xoffset = 0, yoffset = 0; + + if (!supported_image_format(dataFormat)) { + vg_set_error(ctx, VG_UNSUPPORTED_IMAGE_FORMAT_ERROR); + return; + } + if (!data || !is_aligned(data)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + if (sx < 0) { + xoffset = -sx; + xoffset *= _vega_size_for_format(dataFormat); + width += sx; + sx = 0; + } + if (sy < 0) { + yoffset = -sy; + height += sy; + sy = 0; + y = (fb->height - sy) - 1; + yoffset *= dataStride; + } + + { + struct pipe_transfer *transfer; + + transfer = screen->get_tex_transfer(screen, strb->texture, 0, 0, 0, + PIPE_TRANSFER_READ, + 0, 0, width, height); + + /* Do a row at a time to flip image data vertically */ + for (i = 0; i < height; i++) { +#if 0 + debug_printf("%d-%d == %d\n", sy, height, y); +#endif + pipe_get_tile_rgba(transfer, sx, y, width, 1, df); + y += yStep; + _vega_pack_rgba_span_float(ctx, width, temp, dataFormat, + dst + yoffset + xoffset); + dst += dataStride; + } + + screen->tex_transfer_destroy(transfer); + } +} + +void vgCopyPixels(VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + struct st_renderbuffer *strb = ctx->draw_buffer->strb; + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + /* do nothing if we copy from outside the fb */ + if (dx >= (VGint)fb->width || dy >= (VGint)fb->height || + sx >= (VGint)fb->width || sy >= (VGint)fb->height) + return; + + vg_validate_state(ctx); + /* make sure rendering has completed */ + vgFinish(); + + vg_copy_surface(ctx, strb->surface, dx, dy, + strb->surface, sx, sy, width, height); +} diff --git a/src/gallium/state_trackers/vega/api_masks.c b/src/gallium/state_trackers/vega/api_masks.c new file mode 100644 index 0000000000..4f9f3dae17 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_masks.c @@ -0,0 +1,373 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "mask.h" +#include "renderer.h" + +#include "vg_context.h" +#include "pipe/p_context.h" +#include "pipe/p_inlines.h" +#include "pipe/internal/p_winsys_screen.h" /* for winsys->update_buffer */ + +#include "util/u_pack_color.h" +#include "util/u_draw_quad.h" +#include "util/u_memory.h" + + +#define DISABLE_1_1_MASKING 1 + +/** + * Draw a screen-aligned quadrilateral. + * Coords are window coords with y=0=bottom. These coords will be transformed + * by the vertex shader and viewport transform. + */ +static void +draw_clear_quad(struct vg_context *st, + float x0, float y0, float x1, float y1, float z, + const VGfloat color[4]) +{ + struct pipe_context *pipe = st->pipe; + struct pipe_buffer *buf; + VGuint i; + + /* positions */ + st->clear.vertices[0][0][0] = x0; + st->clear.vertices[0][0][1] = y0; + + st->clear.vertices[1][0][0] = x1; + st->clear.vertices[1][0][1] = y0; + + st->clear.vertices[2][0][0] = x1; + st->clear.vertices[2][0][1] = y1; + + st->clear.vertices[3][0][0] = x0; + st->clear.vertices[3][0][1] = y1; + + /* same for all verts: */ + for (i = 0; i < 4; i++) { + st->clear.vertices[i][0][2] = z; + st->clear.vertices[i][0][3] = 1.0; + st->clear.vertices[i][1][0] = color[0]; + st->clear.vertices[i][1][1] = color[1]; + st->clear.vertices[i][1][2] = color[2]; + st->clear.vertices[i][1][3] = color[3]; + } + + + /* put vertex data into vbuf */ + buf = pipe_user_buffer_create(pipe->screen, + st->clear.vertices, + sizeof(st->clear.vertices)); + + + /* draw */ + if (buf) { + util_draw_vertex_buffer(pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference(&buf, NULL); + } +} + +/** + * Do vgClear by drawing a quadrilateral. + */ +static void +clear_with_quad(struct vg_context *st, float x0, float y0, + float width, float height, const VGfloat clear_color[4]) +{ + VGfloat x1, y1; + + vg_validate_state(st); + + x1 = x0 + width; + y1 = y0 + height; + + /* + printf("%s %f,%f %f,%f\n", __FUNCTION__, + x0, y0, + x1, y1); + */ + + if (st->pipe->winsys && st->pipe->winsys->update_buffer) + st->pipe->winsys->update_buffer( st->pipe->winsys, + st->pipe->priv ); + + cso_save_blend(st->cso_context); + cso_save_rasterizer(st->cso_context); + cso_save_fragment_shader(st->cso_context); + cso_save_vertex_shader(st->cso_context); + + /* blend state: RGBA masking */ + { + struct pipe_blend_state blend; + memset(&blend, 0, sizeof(blend)); + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.colormask |= PIPE_MASK_R; + blend.colormask |= PIPE_MASK_G; + blend.colormask |= PIPE_MASK_B; + blend.colormask |= PIPE_MASK_A; + cso_set_blend(st->cso_context, &blend); + } + + cso_set_rasterizer(st->cso_context, &st->clear.raster); + + cso_set_fragment_shader_handle(st->cso_context, st->clear.fs); + cso_set_vertex_shader_handle(st->cso_context, vg_clear_vs(st)); + + /* draw quad matching scissor rect (XXX verify coord round-off) */ + draw_clear_quad(st, x0, y0, x1, y1, 0, clear_color); + + /* Restore pipe state */ + cso_restore_blend(st->cso_context); + cso_restore_rasterizer(st->cso_context); + cso_restore_fragment_shader(st->cso_context); + cso_restore_vertex_shader(st->cso_context); +} + + +void vgMask(VGHandle mask, VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + + if (width <=0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (operation < VG_CLEAR_MASK || operation > VG_SUBTRACT_MASK) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + + vg_validate_state(ctx); + + if (operation == VG_CLEAR_MASK) { + mask_fill(x, y, width, height, 0.f); + } else if (operation == VG_FILL_MASK) { + mask_fill(x, y, width, height, 1.f); + } else if (vg_object_is_valid((void*)mask, VG_OBJECT_IMAGE)) { + struct vg_image *image = (struct vg_image *)mask; + mask_using_image(image, operation, x, y, width, height); + } else if (vg_object_is_valid((void*)mask, VG_OBJECT_MASK)) { +#if DISABLE_1_1_MASKING + return; +#else + struct vg_mask_layer *layer = (struct vg_mask_layer *)mask; + mask_using_layer(layer, operation, x, y, width, height); +#endif + } else { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + } +} + +void vgClear(VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_framebuffer_state *fb; + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + vg_validate_state(ctx); +#if 0 + debug_printf("Clear [%d, %d, %d, %d] with [%f, %f, %f, %f]\n", + x, y, width, height, + ctx->state.vg.clear_color[0], + ctx->state.vg.clear_color[1], + ctx->state.vg.clear_color[2], + ctx->state.vg.clear_color[3]); +#endif + + fb = &ctx->state.g3d.fb; + /* check for a whole surface clear */ + if (!ctx->state.vg.scissoring && + (x == 0 && y == 0 && width == fb->width && height == fb->height)) { + ctx->pipe->clear(ctx->pipe, PIPE_CLEAR_COLOR | PIPE_CLEAR_DEPTHSTENCIL, + ctx->state.vg.clear_color, 1., 0); + } else { + clear_with_quad(ctx, x, y, width, height, ctx->state.vg.clear_color); + } +} + + +#ifdef OPENVG_VERSION_1_1 + + +void vgRenderToMask(VGPath path, + VGbitfield paintModes, + VGMaskOperation operation) +{ + struct vg_context *ctx = vg_current_context(); + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!paintModes || (paintModes&(~(VG_STROKE_PATH|VG_FILL_PATH)))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (operation < VG_CLEAR_MASK || + operation > VG_SUBTRACT_MASK) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!vg_object_is_valid((void*)path, VG_OBJECT_PATH)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + +#if DISABLE_1_1_MASKING + return; +#endif + + vg_validate_state(ctx); + + mask_render_to((struct path *)path, paintModes, operation); +} + +VGMaskLayer vgCreateMaskLayer(VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + + if (width <= 0 || height <= 0 || + width > vgGeti(VG_MAX_IMAGE_WIDTH) || + height > vgGeti(VG_MAX_IMAGE_HEIGHT)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + return (VGMaskLayer)mask_layer_create(width, height); +} + +void vgDestroyMaskLayer(VGMaskLayer maskLayer) +{ + struct vg_mask_layer *mask = 0; + struct vg_context *ctx = vg_current_context(); + + if (maskLayer == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!vg_object_is_valid((void*)maskLayer, VG_OBJECT_MASK)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + mask = (struct vg_mask_layer *)maskLayer; + mask_layer_destroy(mask); +} + +void vgFillMaskLayer(VGMaskLayer maskLayer, + VGint x, VGint y, + VGint width, VGint height, + VGfloat value) +{ + struct vg_mask_layer *mask = 0; + struct vg_context *ctx = vg_current_context(); + + if (maskLayer == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (value < 0 || value > 1) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (x < 0 || y < 0 || (x + width) < 0 || (y + height) < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!vg_object_is_valid((void*)maskLayer, VG_OBJECT_MASK)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + mask = (struct vg_mask_layer*)maskLayer; + + if (x + width > mask_layer_width(mask) || + y + height > mask_layer_height(mask)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + +#if DISABLE_1_1_MASKING + return; +#endif + mask_layer_fill(mask, x, y, width, height, value); +} + +void vgCopyMask(VGMaskLayer maskLayer, + VGint sx, VGint sy, + VGint dx, VGint dy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_mask_layer *mask = 0; + + if (maskLayer == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!vg_object_is_valid((void*)maskLayer, VG_OBJECT_MASK)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + +#if DISABLE_1_1_MASKING + return; +#endif + + mask = (struct vg_mask_layer*)maskLayer; + mask_copy(mask, sx, sy, dx, dy, width, height); +} + +#endif diff --git a/src/gallium/state_trackers/vega/api_misc.c b/src/gallium/state_trackers/vega/api_misc.c new file mode 100644 index 0000000000..78ba0bc110 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_misc.c @@ -0,0 +1,83 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" + +/* Hardware Queries */ +VGHardwareQueryResult vgHardwareQuery(VGHardwareQueryType key, + VGint setting) +{ + struct vg_context *ctx = vg_current_context(); + + if (key < VG_IMAGE_FORMAT_QUERY || + key > VG_PATH_DATATYPE_QUERY) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_HARDWARE_UNACCELERATED; + } + + if (key == VG_IMAGE_FORMAT_QUERY) { + if (setting < VG_sRGBX_8888 || + setting > VG_lABGR_8888_PRE) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_HARDWARE_UNACCELERATED; + } + } else if (key == VG_PATH_DATATYPE_QUERY) { + if (setting < VG_PATH_DATATYPE_S_8 || + setting > VG_PATH_DATATYPE_F) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_HARDWARE_UNACCELERATED; + } + } + /* we're supposed to accelerate everything */ + return VG_HARDWARE_ACCELERATED; +} + +/* Renderer and Extension Information */ +const VGubyte *vgGetString(VGStringID name) +{ + struct vg_context *ctx = vg_current_context(); + static const VGubyte *vendor = (VGubyte *)"Tungsten Graphics, Inc"; + static const VGubyte *renderer = (VGubyte *)"Vega OpenVG 1.0"; + static const VGubyte *version = (VGubyte *)"1.0"; + + if (!ctx) + return NULL; + + switch(name) { + case VG_VENDOR: + return vendor; + case VG_RENDERER: + return renderer; + case VG_VERSION: + return version; + case VG_EXTENSIONS: + return NULL; + default: + return NULL; + } +} diff --git a/src/gallium/state_trackers/vega/api_paint.c b/src/gallium/state_trackers/vega/api_paint.c new file mode 100644 index 0000000000..dd3ac5bdb0 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_paint.c @@ -0,0 +1,166 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "paint.h" +#include "image.h" + +VGPaint vgCreatePaint(void) +{ + return (VGPaint) paint_create(vg_current_context()); +} + +void vgDestroyPaint(VGPaint p) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_paint *paint; + + if (p == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + paint = (struct vg_paint *)p; + paint_destroy(paint); +} + +void vgSetPaint(VGPaint paint, VGbitfield paintModes) +{ + struct vg_context *ctx = vg_current_context(); + + if (paint == VG_INVALID_HANDLE) { + /* restore the default */ + paint = (VGPaint)ctx->default_paint; + } else if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!(paintModes & ((VG_FILL_PATH|VG_STROKE_PATH)))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (paintModes & VG_FILL_PATH) { + ctx->state.vg.fill_paint = (struct vg_paint *)paint; + } + if (paintModes & VG_STROKE_PATH) { + ctx->state.vg.stroke_paint = (struct vg_paint *)paint; + } +} + +VGPaint vgGetPaint(VGPaintMode paintMode) +{ + struct vg_context *ctx = vg_current_context(); + VGPaint paint = VG_INVALID_HANDLE; + + if (paintMode < VG_STROKE_PATH || paintMode > VG_FILL_PATH) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + if (paintMode == VG_FILL_PATH) + paint = (VGPaint)ctx->state.vg.fill_paint; + else if (paintMode == VG_STROKE_PATH) + paint = (VGPaint)ctx->state.vg.stroke_paint; + + if (paint == (VGPaint)ctx->default_paint) + paint = VG_INVALID_HANDLE; + + return paint; +} + +void vgSetColor(VGPaint paint, VGuint rgba) +{ + struct vg_context *ctx = vg_current_context(); + + if (paint == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + { + struct vg_paint *p = (struct vg_paint *)paint; + paint_set_colori(p, rgba); + } +} + +VGuint vgGetColor(VGPaint paint) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_paint *p; + VGuint rgba = 0; + + if (paint == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return rgba; + } + + if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return rgba; + } + p = (struct vg_paint *)paint; + + return paint_colori(p); +} + +void vgPaintPattern(VGPaint paint, VGImage pattern) +{ + struct vg_context *ctx = vg_current_context(); + + if (paint == VG_INVALID_HANDLE || + !vg_context_is_object_valid(ctx, VG_OBJECT_PAINT, (void *)paint)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (pattern == VG_INVALID_HANDLE) { + paint_set_type((struct vg_paint*)paint, VG_PAINT_TYPE_COLOR); + return; + } + + if (!vg_context_is_object_valid(ctx, VG_OBJECT_IMAGE, (void *)pattern)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + + if (!vg_object_is_valid((void*)paint, VG_OBJECT_PAINT) || + !vg_object_is_valid((void*)pattern, VG_OBJECT_IMAGE)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + paint_set_pattern((struct vg_paint*)paint, + (struct vg_image*)pattern); +} + diff --git a/src/gallium/state_trackers/vega/api_params.c b/src/gallium/state_trackers/vega/api_params.c new file mode 100644 index 0000000000..db77fd9cb0 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_params.c @@ -0,0 +1,1673 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "paint.h" +#include "path.h" +#include "image.h" +#include "matrix.h" +#include "api_consts.h" + +#include "pipe/p_compiler.h" +#include "util/u_pointer.h" +#include "util/u_math.h" + +#include <math.h> + +static INLINE struct vg_state *current_state() +{ + struct vg_context *ctx = vg_current_context(); + if (!ctx) + return 0; + else + return &ctx->state.vg; +} + +static INLINE VGboolean count_in_bounds(VGParamType type, VGint count) +{ + if (count < 0) + return VG_FALSE; + + if (type == VG_SCISSOR_RECTS) + return (!(count % 4) && (count >= 0 || count <= VEGA_MAX_SCISSOR_RECTS * 4)); + else if (type == VG_STROKE_DASH_PATTERN) { + return count <= VEGA_MAX_DASH_COUNT; + } else { + VGint real_count = vgGetVectorSize(type); + return count == real_count; + } +} + +void vgSetf (VGParamType type, VGfloat value) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_state *state = current_state(); + VGErrorCode error = VG_NO_ERROR; + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + case VG_MAX_FLOAT: + vgSeti(type, floor(value)); + return; + break; + case VG_STROKE_LINE_WIDTH: + state->stroke.line_width.f = value; + state->stroke.line_width.i = float_to_int_floor(*((VGuint*)(&value))); + break; + case VG_STROKE_MITER_LIMIT: + state->stroke.miter_limit.f = value; + state->stroke.miter_limit.i = float_to_int_floor(*((VGuint*)(&value))); + break; + case VG_STROKE_DASH_PHASE: + state->stroke.dash_phase.f = value; + state->stroke.dash_phase.i = float_to_int_floor(*((VGuint*)(&value))); + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); +} + +void vgSeti (VGParamType type, VGint value) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_state *state = current_state(); + VGErrorCode error = VG_NO_ERROR; + + switch(type) { + case VG_MATRIX_MODE: + if (value < VG_MATRIX_PATH_USER_TO_SURFACE || +#ifdef OPENVG_VERSION_1_1 + value > VG_MATRIX_GLYPH_USER_TO_SURFACE) +#else + value > VG_MATRIX_STROKE_PAINT_TO_USER) +#endif + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->matrix_mode = value; + break; + case VG_FILL_RULE: + if (value < VG_EVEN_ODD || + value > VG_NON_ZERO) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->fill_rule = value; + break; + case VG_IMAGE_QUALITY: + state->image_quality = value; + break; + case VG_RENDERING_QUALITY: + if (value < VG_RENDERING_QUALITY_NONANTIALIASED || + value > VG_RENDERING_QUALITY_BETTER) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->rendering_quality = value; + break; + case VG_BLEND_MODE: + if (value < VG_BLEND_SRC || + value > VG_BLEND_ADDITIVE) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else { + ctx->state.dirty |= BLEND_DIRTY; + state->blend_mode = value; + } + break; + case VG_IMAGE_MODE: + if (value < VG_DRAW_IMAGE_NORMAL || + value > VG_DRAW_IMAGE_STENCIL) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->image_mode = value; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: + state->color_transform = value; +#endif + break; + case VG_STROKE_LINE_WIDTH: + state->stroke.line_width.f = value; + state->stroke.line_width.i = value; + break; + case VG_STROKE_CAP_STYLE: + if (value < VG_CAP_BUTT || + value > VG_CAP_SQUARE) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->stroke.cap_style = value; + break; + case VG_STROKE_JOIN_STYLE: + if (value < VG_JOIN_MITER || + value > VG_JOIN_BEVEL) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->stroke.join_style = value; + break; + case VG_STROKE_MITER_LIMIT: + state->stroke.miter_limit.f = value; + state->stroke.miter_limit.i = value; + break; + case VG_STROKE_DASH_PHASE: + state->stroke.dash_phase.f = value; + state->stroke.dash_phase.i = value; + break; + case VG_STROKE_DASH_PHASE_RESET: + state->stroke.dash_phase_reset = value; + break; + case VG_MASKING: + state->masking = value; + break; + case VG_SCISSORING: + state->scissoring = value; + ctx->state.dirty |= DEPTH_STENCIL_DIRTY; + break; + case VG_PIXEL_LAYOUT: + if (value < VG_PIXEL_LAYOUT_UNKNOWN || + value > VG_PIXEL_LAYOUT_BGR_HORIZONTAL) + error = VG_ILLEGAL_ARGUMENT_ERROR; + else + state->pixel_layout = value; + break; + case VG_SCREEN_LAYOUT: + /* read only ignore */ + break; + case VG_FILTER_FORMAT_LINEAR: + state->filter_format_linear = value; + break; + case VG_FILTER_FORMAT_PREMULTIPLIED: + state->filter_format_premultiplied = value; + break; + case VG_FILTER_CHANNEL_MASK: + state->filter_channel_mask = value; + break; + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + case VG_MAX_FLOAT: + /* read only ignore */ + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); +} + +void vgSetfv(VGParamType type, VGint count, + const VGfloat * values) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_state *state = current_state(); + VGErrorCode error = VG_NO_ERROR; + + if ((count && !values) || !count_in_bounds(type, count) || !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + vgSeti(type, floor(values[0])); + return; + break; + case VG_SCISSOR_RECTS: { + VGint i; + VGuint *x = (VGuint*)values; + for (i = 0; i < count; ++i) { + state->scissor_rects[i].f = values[i]; + state->scissor_rects[i].i = float_to_int_floor(x[i]); + } + state->scissor_rects_num = count / 4; + ctx->state.dirty |= DEPTH_STENCIL_DIRTY; + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM_VALUES: { + VGint i; + for (i = 0; i < count; ++i) { + state->color_transform_values[i] = values[i]; + } + } + break; +#endif + case VG_STROKE_LINE_WIDTH: + state->stroke.line_width.f = values[0]; + state->stroke.line_width.i = float_to_int_floor(*((VGuint*)(values))); + break; + case VG_STROKE_MITER_LIMIT: + state->stroke.miter_limit.f = values[0]; + state->stroke.miter_limit.i = float_to_int_floor(*((VGuint*)(values))); + break; + case VG_STROKE_DASH_PATTERN: { + int i; + for (i = 0; i < count; ++i) { + state->stroke.dash_pattern[i].f = values[i]; + state->stroke.dash_pattern[i].i = + float_to_int_floor(*((VGuint*)(values + i))); + } + state->stroke.dash_pattern_num = count; + } + break; + case VG_STROKE_DASH_PHASE: + state->stroke.dash_phase.f = values[0]; + state->stroke.dash_phase.i = float_to_int_floor(*((VGuint*)(values))); + break; + case VG_TILE_FILL_COLOR: + state->tile_fill_color[0] = values[0]; + state->tile_fill_color[1] = values[1]; + state->tile_fill_color[2] = values[2]; + state->tile_fill_color[3] = values[3]; + + state->tile_fill_colori[0] = float_to_int_floor(*((VGuint*)(values + 0))); + state->tile_fill_colori[1] = float_to_int_floor(*((VGuint*)(values + 1))); + state->tile_fill_colori[2] = float_to_int_floor(*((VGuint*)(values + 2))); + state->tile_fill_colori[3] = float_to_int_floor(*((VGuint*)(values + 3))); + break; + case VG_CLEAR_COLOR: + state->clear_color[0] = values[0]; + state->clear_color[1] = values[1]; + state->clear_color[2] = values[2]; + state->clear_color[3] = values[3]; + + state->clear_colori[0] = float_to_int_floor(*((VGuint*)(values + 0))); + state->clear_colori[1] = float_to_int_floor(*((VGuint*)(values + 1))); + state->clear_colori[2] = float_to_int_floor(*((VGuint*)(values + 2))); + state->clear_colori[3] = float_to_int_floor(*((VGuint*)(values + 3))); + break; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + state->glyph_origin[0].f = values[0]; + state->glyph_origin[1].f = values[1]; + + state->glyph_origin[0].i = float_to_int_floor(*((VGuint*)(values + 0))); + state->glyph_origin[1].i = float_to_int_floor(*((VGuint*)(values + 1))); + break; +#endif + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + case VG_MAX_FLOAT: + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); +} + +void vgSetiv(VGParamType type, VGint count, + const VGint * values) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_state *state = current_state(); + + if ((count && !values) || !count_in_bounds(type, count) || !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + vgSeti(type, values[0]); + return; + break; + case VG_SCISSOR_RECTS: { + VGint i; + for (i = 0; i < count; ++i) { + state->scissor_rects[i].i = values[i]; + state->scissor_rects[i].f = values[i]; + } + state->scissor_rects_num = count / 4; + ctx->state.dirty |= DEPTH_STENCIL_DIRTY; + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM_VALUES: { + VGint i; + for (i = 0; i < count; ++i) { + state->color_transform_values[i] = values[i]; + } + } + break; +#endif + case VG_STROKE_LINE_WIDTH: + state->stroke.line_width.f = values[0]; + state->stroke.line_width.i = values[0]; + break; + case VG_STROKE_MITER_LIMIT: + state->stroke.miter_limit.f = values[0]; + state->stroke.miter_limit.i = values[0]; + break; + case VG_STROKE_DASH_PATTERN: { + int i; + for (i = 0; i < count; ++i) { + state->stroke.dash_pattern[i].f = values[i]; + state->stroke.dash_pattern[i].i = values[i]; + } + state->stroke.dash_pattern_num = count; + } + break; + case VG_STROKE_DASH_PHASE: + state->stroke.dash_phase.f = values[0]; + state->stroke.dash_phase.i = values[0]; + break; + case VG_TILE_FILL_COLOR: + state->tile_fill_color[0] = values[0]; + state->tile_fill_color[1] = values[1]; + state->tile_fill_color[2] = values[2]; + state->tile_fill_color[3] = values[3]; + + state->tile_fill_colori[0] = values[0]; + state->tile_fill_colori[1] = values[1]; + state->tile_fill_colori[2] = values[2]; + state->tile_fill_colori[3] = values[3]; + break; + case VG_CLEAR_COLOR: + state->clear_color[0] = values[0]; + state->clear_color[1] = values[1]; + state->clear_color[2] = values[2]; + state->clear_color[3] = values[3]; + + state->clear_colori[0] = values[0]; + state->clear_colori[1] = values[1]; + state->clear_colori[2] = values[2]; + state->clear_colori[3] = values[3]; + break; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + state->glyph_origin[0].f = values[0]; + state->glyph_origin[1].f = values[1]; + state->glyph_origin[0].i = values[0]; + state->glyph_origin[1].i = values[1]; + break; +#endif + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + case VG_MAX_FLOAT: + break; + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +VGfloat vgGetf(VGParamType type) +{ + struct vg_context *ctx = vg_current_context(); + const struct vg_state *state = current_state(); + VGErrorCode error = VG_NO_ERROR; + VGfloat value = 0.0f; + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + return vgGeti(type); + break; + case VG_STROKE_LINE_WIDTH: + value = state->stroke.line_width.f; + break; + case VG_STROKE_MITER_LIMIT: + value = state->stroke.miter_limit.f; + break; + case VG_STROKE_DASH_PHASE: + value = state->stroke.dash_phase.f; + break; + + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + return vgGeti(type); + break; + case VG_MAX_FLOAT: + value = 1e+10;/*must be at least 1e+10*/ + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); + return value; +} + +VGint vgGeti(VGParamType type) +{ + const struct vg_state *state = current_state(); + struct vg_context *ctx = vg_current_context(); + VGErrorCode error = VG_NO_ERROR; + VGint value = 0; + + switch(type) { + case VG_MATRIX_MODE: + value = state->matrix_mode; + break; + case VG_FILL_RULE: + value = state->fill_rule; + break; + case VG_IMAGE_QUALITY: + value = state->image_quality; + break; + case VG_RENDERING_QUALITY: + value = state->rendering_quality; + break; + case VG_BLEND_MODE: + value = state->blend_mode; + break; + case VG_IMAGE_MODE: + value = state->image_mode; + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: + value = state->color_transform; + break; +#endif + case VG_STROKE_LINE_WIDTH: + value = state->stroke.line_width.i; + break; + case VG_STROKE_CAP_STYLE: + value = state->stroke.cap_style; + break; + case VG_STROKE_JOIN_STYLE: + value = state->stroke.join_style; + break; + case VG_STROKE_MITER_LIMIT: + value = state->stroke.miter_limit.i; + break; + case VG_STROKE_DASH_PHASE: + value = state->stroke.dash_phase.i; + break; + case VG_STROKE_DASH_PHASE_RESET: + value = state->stroke.dash_phase_reset; + break; + case VG_MASKING: + value = state->masking; + break; + case VG_SCISSORING: + value = state->scissoring; + break; + case VG_PIXEL_LAYOUT: + value = state->pixel_layout; + break; + case VG_SCREEN_LAYOUT: + value = state->screen_layout; + break; + case VG_FILTER_FORMAT_LINEAR: + value = state->filter_format_linear; + break; + case VG_FILTER_FORMAT_PREMULTIPLIED: + value = state->filter_format_premultiplied; + break; + case VG_FILTER_CHANNEL_MASK: + value = state->filter_channel_mask; + break; + + case VG_MAX_SCISSOR_RECTS: + value = 32; /*must be at least 32*/ + break; + case VG_MAX_DASH_COUNT: + value = 16; /*must be at least 16*/ + break; + case VG_MAX_KERNEL_SIZE: + value = 7; /*must be at least 7*/ + break; + case VG_MAX_SEPARABLE_KERNEL_SIZE: + value = 15; /*must be at least 15*/ + break; + case VG_MAX_COLOR_RAMP_STOPS: + value = 256; /*must be at least 32*/ + break; + case VG_MAX_IMAGE_WIDTH: + value = 2048; + break; + case VG_MAX_IMAGE_HEIGHT: + value = 2048; + break; + case VG_MAX_IMAGE_PIXELS: + value = 2048*2048; + break; + case VG_MAX_IMAGE_BYTES: + value = 2048*2048 * 4; + break; + case VG_MAX_GAUSSIAN_STD_DEVIATION: + value = 128; /*must be at least 128*/ + break; + + case VG_MAX_FLOAT: { + VGfloat val = vgGetf(type); + value = float_to_int_floor(*((VGuint*)&val)); + } + break; + default: + error = VG_ILLEGAL_ARGUMENT_ERROR; + break; + } + vg_set_error(ctx, error); + return value; +} + +VGint vgGetVectorSize(VGParamType type) +{ + struct vg_context *ctx = vg_current_context(); + const struct vg_state *state = current_state(); + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: + return 1; + case VG_SCISSOR_RECTS: + return state->scissor_rects_num * 4; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: + return 1; + case VG_COLOR_TRANSFORM_VALUES: + return 8; +#endif + case VG_STROKE_LINE_WIDTH: + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_MITER_LIMIT: + return 1; + case VG_STROKE_DASH_PATTERN: + return state->stroke.dash_pattern_num; + case VG_STROKE_DASH_PHASE: + return 1; + case VG_STROKE_DASH_PHASE_RESET: + return 1; + case VG_TILE_FILL_COLOR: + return 4; + case VG_CLEAR_COLOR: + return 4; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + return 2; +#endif + case VG_MASKING: + return 1; + case VG_SCISSORING: + return 1; + case VG_PIXEL_LAYOUT: + return 1; + case VG_SCREEN_LAYOUT: + return 1; + case VG_FILTER_FORMAT_LINEAR: + return 1; + case VG_FILTER_FORMAT_PREMULTIPLIED: + return 1; + case VG_FILTER_CHANNEL_MASK: + return 1; + + case VG_MAX_COLOR_RAMP_STOPS: + return 1; + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_FLOAT: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + return 1; + default: + if (ctx) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return 0; + } +} + +void vgGetfv(VGParamType type, VGint count, + VGfloat * values) +{ + const struct vg_state *state = current_state(); + struct vg_context *ctx = vg_current_context(); + VGint real_count = vgGetVectorSize(type); + + if (!values || count <= 0 || count > real_count || !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + values[0] = vgGeti(type); + break; + case VG_MAX_FLOAT: + values[0] = vgGetf(type); + break; + case VG_SCISSOR_RECTS: { + VGint i; + for (i = 0; i < count; ++i) { + values[i] = state->scissor_rects[i].f; + } + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM_VALUES: { + memcpy(values, state->color_transform_values, + sizeof(VGfloat) * count); + } + break; +#endif + case VG_STROKE_LINE_WIDTH: + values[0] = state->stroke.line_width.f; + break; + case VG_STROKE_MITER_LIMIT: + values[0] = state->stroke.miter_limit.f; + break; + case VG_STROKE_DASH_PATTERN: { + VGint i; + for (i = 0; i < count; ++i) { + values[i] = state->stroke.dash_pattern[i].f; + } + } + break; + case VG_STROKE_DASH_PHASE: + values[0] = state->stroke.dash_phase.f; + break; + case VG_TILE_FILL_COLOR: + values[0] = state->tile_fill_color[0]; + values[1] = state->tile_fill_color[1]; + values[2] = state->tile_fill_color[2]; + values[3] = state->tile_fill_color[3]; + break; + case VG_CLEAR_COLOR: + values[0] = state->clear_color[0]; + values[1] = state->clear_color[1]; + values[2] = state->clear_color[2]; + values[3] = state->clear_color[3]; + break; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + values[0] = state->glyph_origin[0].f; + values[1] = state->glyph_origin[1].f; + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +void vgGetiv(VGParamType type, VGint count, + VGint * values) +{ + const struct vg_state *state = current_state(); + struct vg_context *ctx = vg_current_context(); + VGint real_count = vgGetVectorSize(type); + + if (!values || count <= 0 || count > real_count || !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(type) { + case VG_MATRIX_MODE: + case VG_FILL_RULE: + case VG_IMAGE_QUALITY: + case VG_RENDERING_QUALITY: + case VG_BLEND_MODE: + case VG_IMAGE_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM: +#endif + case VG_STROKE_CAP_STYLE: + case VG_STROKE_JOIN_STYLE: + case VG_STROKE_DASH_PHASE_RESET: + case VG_MASKING: + case VG_SCISSORING: + case VG_PIXEL_LAYOUT: + case VG_SCREEN_LAYOUT: + case VG_FILTER_FORMAT_LINEAR: + case VG_FILTER_FORMAT_PREMULTIPLIED: + case VG_FILTER_CHANNEL_MASK: + case VG_MAX_SCISSOR_RECTS: + case VG_MAX_DASH_COUNT: + case VG_MAX_KERNEL_SIZE: + case VG_MAX_SEPARABLE_KERNEL_SIZE: + case VG_MAX_COLOR_RAMP_STOPS: + case VG_MAX_IMAGE_WIDTH: + case VG_MAX_IMAGE_HEIGHT: + case VG_MAX_IMAGE_PIXELS: + case VG_MAX_IMAGE_BYTES: + case VG_MAX_GAUSSIAN_STD_DEVIATION: + values[0] = vgGeti(type); + break; + case VG_MAX_FLOAT: { + VGfloat val = vgGetf(type); + values[0] = float_to_int_floor(*((VGuint*)&val)); + } + break; + case VG_SCISSOR_RECTS: { + VGint i; + for (i = 0; i < count; ++i) { + values[i] = state->scissor_rects[i].i; + } + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_COLOR_TRANSFORM_VALUES: { + VGint i; + VGuint *x = (VGuint*)state->color_transform_values; + for (i = 0; i < count; ++i) { + values[i] = float_to_int_floor(x[i]); + } + } + break; +#endif + case VG_STROKE_LINE_WIDTH: + values[0] = state->stroke.line_width.i; + break; + case VG_STROKE_MITER_LIMIT: + values[0] = state->stroke.miter_limit.i; + break; + case VG_STROKE_DASH_PATTERN: { + VGint i; + for (i = 0; i < count; ++i) { + values[i] = state->stroke.dash_pattern[i].i; + } + } + break; + case VG_STROKE_DASH_PHASE: + values[0] = state->stroke.dash_phase.i; + break; + case VG_TILE_FILL_COLOR: + values[0] = state->tile_fill_colori[0]; + values[1] = state->tile_fill_colori[1]; + values[2] = state->tile_fill_colori[2]; + values[3] = state->tile_fill_colori[3]; + break; + case VG_CLEAR_COLOR: + values[0] = state->clear_colori[0]; + values[1] = state->clear_colori[1]; + values[2] = state->clear_colori[2]; + values[3] = state->clear_colori[3]; + break; +#ifdef OPENVG_VERSION_1_1 + case VG_GLYPH_ORIGIN: + values[0] = state->glyph_origin[0].i; + values[1] = state->glyph_origin[1].i; + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +void vgSetParameterf(VGHandle object, + VGint paramType, + VGfloat value) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_PATTERN_TILING_MODE: + vgSetParameteri(object, paramType, floor(value)); + return; + break; + case VG_PAINT_COLOR: + case VG_PAINT_COLOR_RAMP_STOPS: + case VG_PAINT_LINEAR_GRADIENT: + case VG_PAINT_RADIAL_GRADIENT: + /* it's an error if paramType refers to a vector parameter */ + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: { + struct vg_paint *p = (struct vg_paint *)object; + paint_set_color_ramp_premultiplied(p, value); + } + break; + + case VG_PATH_DATATYPE: + case VG_PATH_FORMAT: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + /* read only don't produce an error */ + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +void vgSetParameteri(VGHandle object, + VGint paramType, + VGint value) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + if (value < VG_PAINT_TYPE_COLOR || + value > VG_PAINT_TYPE_PATTERN) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)ptr; + paint_set_type(paint, value); + } + break; + case VG_PAINT_COLOR: + case VG_PAINT_COLOR_RAMP_STOPS: + case VG_PAINT_LINEAR_GRADIENT: + case VG_PAINT_RADIAL_GRADIENT: + /* it's an error if paramType refers to a vector parameter */ + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + if (value < VG_COLOR_RAMP_SPREAD_PAD || + value > VG_COLOR_RAMP_SPREAD_REFLECT) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)ptr; + paint_set_spread_mode(paint, value); + } + break; + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: { + struct vg_paint *p = (struct vg_paint *)object; + paint_set_color_ramp_premultiplied(p, value); + } + break; + case VG_PAINT_PATTERN_TILING_MODE: + if (value < VG_TILE_FILL || + value > VG_TILE_REFLECT) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)ptr; + paint_set_pattern_tiling(paint, value); + } + break; + + case VG_PATH_DATATYPE: + case VG_PATH_FORMAT: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + /* read only don't produce an error */ + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } +} + +void vgSetParameterfv(VGHandle object, + VGint paramType, + VGint count, + const VGfloat * values) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + VGint real_count = vgGetParameterVectorSize(object, paramType); + + if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (count < 0 || count < real_count || + (values == NULL && count != 0) || + !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: + if (count != 1) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else + vgSetParameterf(object, paramType, values[0]); + return; + break; + case VG_PAINT_COLOR: { + if (count != 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + paint_set_color(paint, values); + } + } + break; + case VG_PAINT_COLOR_RAMP_STOPS: { + if (count && count < 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + count = MIN2(count, VEGA_MAX_COLOR_RAMP_STOPS); + paint_set_ramp_stops(paint, values, count); + { + VGint stopsi[VEGA_MAX_COLOR_RAMP_STOPS]; + int i = 0; + for (i = 0; i < count; ++i) { + stopsi[i] = float_to_int_floor(*((VGuint*)(values + i))); + } + paint_set_ramp_stopsi(paint, stopsi, count); + } + } + } + break; + case VG_PAINT_LINEAR_GRADIENT: { + if (count != 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + paint_set_linear_gradient(paint, values); + { + VGint vals[4]; + vals[0] = FLT_TO_INT(values[0]); + vals[1] = FLT_TO_INT(values[1]); + vals[2] = FLT_TO_INT(values[2]); + vals[3] = FLT_TO_INT(values[3]); + paint_set_linear_gradienti(paint, vals); + } + } + } + break; + case VG_PAINT_RADIAL_GRADIENT: { + if (count != 5) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + paint_set_radial_gradient(paint, values); + { + VGint vals[5]; + vals[0] = FLT_TO_INT(values[0]); + vals[1] = FLT_TO_INT(values[1]); + vals[2] = FLT_TO_INT(values[2]); + vals[3] = FLT_TO_INT(values[3]); + vals[4] = FLT_TO_INT(values[4]); + paint_set_radial_gradienti(paint, vals); + } + } + } + break; + + case VG_PATH_DATATYPE: + case VG_PATH_FORMAT: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + /* read only don't produce an error */ + break; +#endif + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } +} + +void vgSetParameteriv(VGHandle object, + VGint paramType, + VGint count, + const VGint * values) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + VGint real_count = vgGetParameterVectorSize(object, paramType); + + if (!object || object == VG_INVALID_HANDLE || !is_aligned(ptr)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (count < 0 || count < real_count || + (values == NULL && count != 0) || + !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: + if (count != 1) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else + vgSetParameteri(object, paramType, values[0]); + return; + break; + case VG_PAINT_COLOR: { + if (count != 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + struct vg_paint *paint = (struct vg_paint *)object; + paint_set_coloriv(paint, values); + } + } + break; + case VG_PAINT_COLOR_RAMP_STOPS: { + if ((count % 5)) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + VGfloat *vals = 0; + int i; + struct vg_paint *paint = (struct vg_paint *)object; + if (count) { + vals = malloc(sizeof(VGfloat)*count); + for (i = 0; i < count; ++i) + vals[i] = values[i]; + } + + paint_set_ramp_stopsi(paint, values, count); + paint_set_ramp_stops(paint, vals, count); + free(vals); + } + } + break; + case VG_PAINT_LINEAR_GRADIENT: { + if (count != 4) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + VGfloat vals[4]; + struct vg_paint *paint = (struct vg_paint *)object; + vals[0] = values[0]; + vals[1] = values[1]; + vals[2] = values[2]; + vals[3] = values[3]; + paint_set_linear_gradient(paint, vals); + paint_set_linear_gradienti(paint, values); + } + } + break; + case VG_PAINT_RADIAL_GRADIENT: { + if (count != 5) + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + else { + VGfloat vals[5]; + struct vg_paint *paint = (struct vg_paint *)object; + vals[0] = values[0]; + vals[1] = values[1]; + vals[2] = values[2]; + vals[3] = values[3]; + vals[4] = values[4]; + paint_set_radial_gradient(paint, vals); + paint_set_radial_gradienti(paint, values); + } + } + break; + case VG_PATH_DATATYPE: + case VG_PATH_FORMAT: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + /* read only don't produce an error */ + break; + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } +} + +VGint vgGetParameterVectorSize(VGHandle object, + VGint paramType) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return 0; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: + return 1; + case VG_PAINT_COLOR: + return 4; + case VG_PAINT_COLOR_RAMP_STOPS: { + struct vg_paint *p = (struct vg_paint *)object; + return paint_num_ramp_stops(p); + } + break; + case VG_PAINT_LINEAR_GRADIENT: + return 4; + case VG_PAINT_RADIAL_GRADIENT: + return 5; + + + case VG_PATH_FORMAT: + case VG_PATH_DATATYPE: + case VG_PATH_SCALE: + case VG_PATH_BIAS: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + return 1; + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: + return 1; + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + return 1; +#endif + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } + return 0; +} + + +VGfloat vgGetParameterf(VGHandle object, + VGint paramType) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return 0; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: + return vgGetParameteri(object, paramType); + break; + case VG_PAINT_COLOR: + case VG_PAINT_COLOR_RAMP_STOPS: + case VG_PAINT_LINEAR_GRADIENT: + case VG_PAINT_RADIAL_GRADIENT: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + + case VG_PATH_FORMAT: + return VG_PATH_FORMAT_STANDARD; + case VG_PATH_SCALE: { + struct path *p = (struct path*)object; + return path_scale(p); + } + case VG_PATH_BIAS: { + struct path *p = (struct path*)object; + return path_bias(p); + } + case VG_PATH_DATATYPE: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + return vgGetParameteri(object, paramType); + break; + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + return vgGetParameteri(object, paramType); + break; +#endif + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } + return 0; +} + +VGint vgGetParameteri(VGHandle object, + VGint paramType) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return 0; + } + + switch(paramType) { + case VG_PAINT_TYPE: { + struct vg_paint *paint = (struct vg_paint *)ptr; + return paint_type(paint); + } + break; + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: { + struct vg_paint *p = (struct vg_paint *)object; + return paint_spread_mode(p); + } + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: { + struct vg_paint *p = (struct vg_paint *)object; + return paint_color_ramp_premultiplied(p); + } + break; + case VG_PAINT_PATTERN_TILING_MODE: { + struct vg_paint *p = (struct vg_paint *)object; + return paint_pattern_tiling(p); + } + break; + case VG_PAINT_COLOR: + case VG_PAINT_COLOR_RAMP_STOPS: + case VG_PAINT_LINEAR_GRADIENT: + case VG_PAINT_RADIAL_GRADIENT: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + + case VG_PATH_FORMAT: + return VG_PATH_FORMAT_STANDARD; + case VG_PATH_SCALE: + case VG_PATH_BIAS: + return vgGetParameterf(object, paramType); + case VG_PATH_DATATYPE: { + struct path *p = (struct path*)object; + return path_datatype(p); + } + case VG_PATH_NUM_SEGMENTS: { + struct path *p = (struct path*)object; + return path_num_segments(p); + } + case VG_PATH_NUM_COORDS: { + struct path *p = (struct path*)object; + return path_num_coords(p); + } + break; + + case VG_IMAGE_FORMAT: { + struct vg_image *img = (struct vg_image*)object; + return img->format; + } + break; + case VG_IMAGE_WIDTH: { + struct vg_image *img = (struct vg_image*)object; + return img->width; + } + break; + case VG_IMAGE_HEIGHT: { + struct vg_image *img = (struct vg_image*)object; + return img->height; + } + break; + +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: { + return 1; + } + break; +#endif + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } + return 0; +} + +void vgGetParameterfv(VGHandle object, + VGint paramType, + VGint count, + VGfloat * values) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + VGint real_count = vgGetParameterVectorSize(object, paramType); + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!values || count <= 0 || count > real_count || + !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: { + struct vg_paint *p = (struct vg_paint *)object; + values[0] = paint_type(p); + } + break; + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: { + struct vg_paint *p = (struct vg_paint *)object; + values[0] = paint_spread_mode(p); + } + break; + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: { + struct vg_paint *p = (struct vg_paint *)object; + values[0] = paint_color_ramp_premultiplied(p); + } + break; + case VG_PAINT_PATTERN_TILING_MODE: { + values[0] = vgGetParameterf(object, paramType); + } + break; + case VG_PAINT_COLOR: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_get_color(paint, values); + } + break; + case VG_PAINT_COLOR_RAMP_STOPS: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_ramp_stops(paint, values, count); + } + break; + case VG_PAINT_LINEAR_GRADIENT: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_linear_gradient(paint, values); + } + break; + case VG_PAINT_RADIAL_GRADIENT: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_radial_gradient(paint, values); + } + break; + + case VG_PATH_FORMAT: + case VG_PATH_DATATYPE: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + values[0] = vgGetParameteri(object, paramType); + break; + case VG_PATH_SCALE: + case VG_PATH_BIAS: + values[0] = vgGetParameterf(object, paramType); + break; + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + values[0] = vgGetParameteri(object, paramType); + break; +#endif + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} + +void vgGetParameteriv(VGHandle object, + VGint paramType, + VGint count, + VGint * values) +{ + struct vg_context *ctx = vg_current_context(); + void *ptr = (void*)object; + VGint real_count = vgGetParameterVectorSize(object, paramType); + + if (!ptr || object == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!values || count <= 0 || count > real_count || + !is_aligned(values)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + switch(paramType) { + case VG_PAINT_TYPE: + case VG_PAINT_COLOR_RAMP_SPREAD_MODE: + case VG_PAINT_COLOR_RAMP_PREMULTIPLIED: + case VG_PAINT_PATTERN_TILING_MODE: +#ifdef OPENVG_VERSION_1_1 + case VG_FONT_NUM_GLYPHS: + values[0] = vgGetParameteri(object, paramType); + break; +#endif + case VG_PAINT_COLOR: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_get_coloriv(paint, values); + } + break; + case VG_PAINT_COLOR_RAMP_STOPS: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_ramp_stopsi(paint, values, count); + } + break; + case VG_PAINT_LINEAR_GRADIENT: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_linear_gradienti(paint, values); + } + break; + case VG_PAINT_RADIAL_GRADIENT: { + struct vg_paint *paint = (struct vg_paint *)object; + paint_radial_gradienti(paint, values); + } + break; + + case VG_PATH_SCALE: + case VG_PATH_BIAS: + values[0] = vgGetParameterf(object, paramType); + break; + case VG_PATH_FORMAT: + case VG_PATH_DATATYPE: + case VG_PATH_NUM_SEGMENTS: + case VG_PATH_NUM_COORDS: + values[0] = vgGetParameteri(object, paramType); + break; + + case VG_IMAGE_FORMAT: + case VG_IMAGE_WIDTH: + case VG_IMAGE_HEIGHT: + values[0] = vgGetParameteri(object, paramType); + break; + + default: + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + break; + } +} diff --git a/src/gallium/state_trackers/vega/api_path.c b/src/gallium/state_trackers/vega/api_path.c new file mode 100644 index 0000000000..a6b7a2bb93 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_path.c @@ -0,0 +1,488 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" +#include "path.h" +#include "polygon.h" +#include "paint.h" + +#include "pipe/p_context.h" +#include "pipe/p_inlines.h" +#include "util/u_draw_quad.h" + +VGPath vgCreatePath(VGint pathFormat, + VGPathDatatype datatype, + VGfloat scale, VGfloat bias, + VGint segmentCapacityHint, + VGint coordCapacityHint, + VGbitfield capabilities) +{ + struct vg_context *ctx = vg_current_context(); + + if (pathFormat != VG_PATH_FORMAT_STANDARD) { + vg_set_error(ctx, VG_UNSUPPORTED_PATH_FORMAT_ERROR); + return VG_INVALID_HANDLE; + } + if (datatype < VG_PATH_DATATYPE_S_8 || + datatype > VG_PATH_DATATYPE_F) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + if (!scale) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + return (VGPath)path_create(datatype, scale, bias, + segmentCapacityHint, coordCapacityHint, + capabilities); +} + +void vgClearPath(VGPath path, VGbitfield capabilities) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + p = (struct path *)path; + path_clear(p, capabilities); +} + +void vgDestroyPath(VGPath p) +{ + struct path *path = 0; + struct vg_context *ctx = vg_current_context(); + + if (p == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + path = (struct path *)p; + path_destroy(path); +} + +void vgRemovePathCapabilities(VGPath path, + VGbitfield capabilities) +{ + struct vg_context *ctx = vg_current_context(); + VGbitfield current; + struct path *p; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + p = (struct path*)path; + current = path_capabilities(p); + path_set_capabilities(p, (current & + (~(capabilities & VG_PATH_CAPABILITY_ALL)))); +} + +VGbitfield vgGetPathCapabilities(VGPath path) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return 0; + } + p = (struct path*)path; + return path_capabilities(p); +} + +void vgAppendPath(VGPath dstPath, VGPath srcPath) +{ + struct vg_context *ctx = vg_current_context(); + struct path *src, *dst; + + if (dstPath == VG_INVALID_HANDLE || srcPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + src = (struct path *)srcPath; + dst = (struct path *)dstPath; + + if (!(path_capabilities(src) & VG_PATH_CAPABILITY_APPEND_FROM) || + !(path_capabilities(dst) & VG_PATH_CAPABILITY_APPEND_TO)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + path_append_path(dst, src); +} + +void vgAppendPathData(VGPath dstPath, + VGint numSegments, + const VGubyte * pathSegments, + const void * pathData) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + VGint i; + + if (dstPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!pathSegments) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (numSegments <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + for (i = 0; i < numSegments; ++i) { + if (pathSegments[i] < VG_CLOSE_PATH || + pathSegments[i] > VG_LCWARC_TO_REL) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + } + + p = (struct path*)dstPath; + + if (!pathData || !is_aligned_to(pathData, path_datatype_size(p))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!(path_capabilities(p)&VG_PATH_CAPABILITY_APPEND_TO)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + + path_append_data(p, numSegments, pathSegments, pathData); +} + +void vgModifyPathCoords(VGPath dstPath, + VGint startIndex, + VGint numSegments, + const void * pathData) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + + if (dstPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (startIndex < 0 || numSegments <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + p = (struct path *)dstPath; + + if (!pathData || !is_aligned_to(pathData, path_datatype_size(p))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (startIndex + numSegments > path_num_segments(p)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!(path_capabilities(p)&VG_PATH_CAPABILITY_MODIFY)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + path_modify_coords(p, startIndex, numSegments, pathData); +} + +void vgTransformPath(VGPath dstPath, VGPath srcPath) +{ + struct vg_context *ctx = vg_current_context(); + struct path *src = 0, *dst = 0; + + if (dstPath == VG_INVALID_HANDLE || srcPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + src = (struct path *)srcPath; + dst = (struct path *)dstPath; + + if (!(path_capabilities(src) & VG_PATH_CAPABILITY_TRANSFORM_FROM) || + !(path_capabilities(dst) & VG_PATH_CAPABILITY_TRANSFORM_TO)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + path_transform(dst, src); +} + +VGboolean vgInterpolatePath(VGPath dstPath, + VGPath startPath, + VGPath endPath, + VGfloat amount) +{ + struct vg_context *ctx = vg_current_context(); + struct path *start = 0, *dst = 0, *end = 0; + + if (dstPath == VG_INVALID_HANDLE || + startPath == VG_INVALID_HANDLE || + endPath == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return VG_FALSE; + } + dst = (struct path *)dstPath; + start = (struct path *)startPath; + end = (struct path *)endPath; + + if (!(path_capabilities(dst) & VG_PATH_CAPABILITY_INTERPOLATE_TO) || + !(path_capabilities(start) & VG_PATH_CAPABILITY_INTERPOLATE_FROM) || + !(path_capabilities(end) & VG_PATH_CAPABILITY_INTERPOLATE_FROM)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return VG_FALSE; + } + + return path_interpolate(dst, + start, end, amount); +} + +VGfloat vgPathLength(VGPath path, + VGint startSegment, + VGint numSegments) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return -1; + } + if (startSegment < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return -1; + } + if (numSegments <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return -1; + } + p = (struct path*)path; + + if (!(path_capabilities(p) & VG_PATH_CAPABILITY_PATH_LENGTH)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return -1; + } + if (startSegment + numSegments > path_num_segments(p)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return -1; + } + + return path_length(p, startSegment, numSegments); +} + +void vgPointAlongPath(VGPath path, + VGint startSegment, + VGint numSegments, + VGfloat distance, + VGfloat * x, VGfloat * y, + VGfloat * tangentX, + VGfloat * tangentY) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (startSegment < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (numSegments <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!is_aligned(x) || !is_aligned(y) || + !is_aligned(tangentX) || !is_aligned(tangentY)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + p = (struct path*)path; + + caps = path_capabilities(p); + if (!(caps & VG_PATH_CAPABILITY_POINT_ALONG_PATH) || + !(caps & VG_PATH_CAPABILITY_TANGENT_ALONG_PATH)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + + if (startSegment + numSegments > path_num_segments(p)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + { + VGfloat point[2], normal[2]; + path_point(p, startSegment, numSegments, distance, + point, normal); + if (x) + *x = point[0]; + if (y) + *y = point[1]; + if (tangentX) + *tangentX = -normal[1]; + if (tangentY) + *tangentY = normal[0]; + } +} + +void vgPathBounds(VGPath path, + VGfloat * minX, + VGfloat * minY, + VGfloat * width, + VGfloat * height) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!minX || !minY || !width || !height) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!is_aligned(minX) || !is_aligned(minY) || + !is_aligned(width) || !is_aligned(height)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + p = (struct path*)path; + + caps = path_capabilities(p); + if (!(caps & VG_PATH_CAPABILITY_PATH_BOUNDS)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + + path_bounding_rect(p, minX, minY, width, height); +} + +void vgPathTransformedBounds(VGPath path, + VGfloat * minX, + VGfloat * minY, + VGfloat * width, + VGfloat * height) +{ + struct vg_context *ctx = vg_current_context(); + struct path *p = 0; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!minX || !minY || !width || !height) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (!is_aligned(minX) || !is_aligned(minY) || + !is_aligned(width) || !is_aligned(height)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + p = (struct path*)path; + + caps = path_capabilities(p); + if (!(caps & VG_PATH_CAPABILITY_PATH_TRANSFORMED_BOUNDS)) { + vg_set_error(ctx, VG_PATH_CAPABILITY_ERROR); + return; + } + +#if 0 + /* faster, but seems to have precision problems... */ + path_bounding_rect(p, minX, minY, width, height); + if (*width > 0 && *height > 0) { + VGfloat pts[] = {*minX, *minY, + *minX + *width, *minY, + *minX + *width, *minY + *height, + *minX, *minY + *height}; + struct matrix *matrix = &ctx->state.vg.path_user_to_surface_matrix; + VGfloat maxX, maxY; + matrix_map_point(matrix, pts[0], pts[1], pts + 0, pts + 1); + matrix_map_point(matrix, pts[2], pts[3], pts + 2, pts + 3); + matrix_map_point(matrix, pts[4], pts[5], pts + 4, pts + 5); + matrix_map_point(matrix, pts[6], pts[7], pts + 6, pts + 7); + *minX = MIN2(pts[0], MIN2(pts[2], MIN2(pts[4], pts[6]))); + *minY = MIN2(pts[1], MIN2(pts[3], MIN2(pts[5], pts[7]))); + maxX = MAX2(pts[0], MAX2(pts[2], MAX2(pts[4], pts[6]))); + maxY = MAX2(pts[1], MAX2(pts[3], MAX2(pts[5], pts[7]))); + *width = maxX - *minX; + *height = maxY - *minY; + } +#else + { + struct path *dst = path_create(VG_PATH_DATATYPE_F, 1.0, 0, + 0, 0, VG_PATH_CAPABILITY_ALL); + path_transform(dst, p); + path_bounding_rect(dst, minX, minY, width, height); + path_destroy(dst); + } +#endif +} + + +void vgDrawPath(VGPath path, VGbitfield paintModes) +{ + struct vg_context *ctx = vg_current_context(); + + if (path == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + if (!(paintModes & (VG_STROKE_PATH | VG_FILL_PATH))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (path_is_empty((struct path*)path)) + return; + path_render((struct path*)path, paintModes); +} + diff --git a/src/gallium/state_trackers/vega/api_text.c b/src/gallium/state_trackers/vega/api_text.c new file mode 100644 index 0000000000..d8411cf3e8 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_text.c @@ -0,0 +1,258 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" + +#include "util/u_memory.h" + +#ifdef OPENVG_VERSION_1_1 + +struct vg_font { + struct vg_object base; + + VGint glyph_indices[200]; + VGint num_glyphs; +}; + +VGFont vgCreateFont(VGint glyphCapacityHint) +{ + struct vg_font *font = 0; + struct vg_context *ctx = vg_current_context(); + + if (glyphCapacityHint < 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return VG_INVALID_HANDLE; + } + + font = CALLOC_STRUCT(vg_font); + vg_init_object(&font->base, ctx, VG_OBJECT_FONT); + vg_context_add_object(ctx, VG_OBJECT_FONT, font); + return (VGFont)font; +} + +void vgDestroyFont(VGFont f) +{ + struct vg_font *font = (struct vg_font *)f; + struct vg_context *ctx = vg_current_context(); + + if (f == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + vg_context_remove_object(ctx, VG_OBJECT_FONT, font); + /*free(font);*/ +} + +void vgSetGlyphToPath(VGFont font, + VGuint glyphIndex, + VGPath path, + VGboolean isHinted, + VGfloat glyphOrigin [2], + VGfloat escapement[2]) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_object *pathObj; + struct vg_font *f; + + if (font == VG_INVALID_HANDLE || + !vg_context_is_object_valid(ctx, VG_OBJECT_FONT, (void *)font)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!glyphOrigin || !escapement || + !is_aligned(glyphOrigin) || !is_aligned(escapement)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (path != VG_INVALID_HANDLE && + !vg_context_is_object_valid(ctx, VG_OBJECT_PATH, (void *)path)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + pathObj = (struct vg_object*)path; + if (pathObj && pathObj->type != VG_OBJECT_PATH) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + + f = (struct vg_font*)font; + f->glyph_indices[f->num_glyphs] = glyphIndex; + ++f->num_glyphs; +} + +void vgSetGlyphToImage(VGFont font, + VGuint glyphIndex, + VGImage image, + VGfloat glyphOrigin [2], + VGfloat escapement[2]) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_object *img_obj; + struct vg_font *f; + + if (font == VG_INVALID_HANDLE || + !vg_context_is_object_valid(ctx, VG_OBJECT_FONT, (void *)font)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (!glyphOrigin || !escapement || + !is_aligned(glyphOrigin) || !is_aligned(escapement)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (image != VG_INVALID_HANDLE && + !vg_context_is_object_valid(ctx, VG_OBJECT_IMAGE, (void *)image)) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + img_obj = (struct vg_object*)image; + if (img_obj && img_obj->type != VG_OBJECT_IMAGE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + f = (struct vg_font*)font; + f->glyph_indices[f->num_glyphs] = glyphIndex; + ++f->num_glyphs; +} + +static INLINE VGboolean font_contains_glyph(struct vg_font *font, + VGuint glyph_index) +{ + VGint i; + for (i = 0; i < font->num_glyphs; ++i) { + if (font->glyph_indices[i] == glyph_index) { + return VG_TRUE; + } + } + return VG_FALSE; +} + +void vgClearGlyph(VGFont font, + VGuint glyphIndex) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_font *f; + VGint i; + + if (font == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (glyphIndex <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + f = (struct vg_font*)font; + if (!font_contains_glyph(f, glyphIndex)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + for (i = 0; i < f->num_glyphs; ++i) { + if (f->glyph_indices[i] == glyphIndex) { + /*FIXME*/ + f->glyph_indices[f->num_glyphs] = 0; + --f->num_glyphs; + return; + } + } +} + +void vgDrawGlyph(VGFont font, + VGuint glyphIndex, + VGbitfield paintModes, + VGboolean allowAutoHinting) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_font *f; + + if (font == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (glyphIndex <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (paintModes & (~(VG_STROKE_PATH|VG_FILL_PATH))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + f = (struct vg_font*)font; + if (!font_contains_glyph(f, glyphIndex)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } +} + +void vgDrawGlyphs(VGFont font, + VGint glyphCount, + VGuint *glyphIndices, + VGfloat *adjustments_x, + VGfloat *adjustments_y, + VGbitfield paintModes, + VGboolean allowAutoHinting) +{ + struct vg_context *ctx = vg_current_context(); + VGint i; + struct vg_font *f; + + if (font == VG_INVALID_HANDLE) { + vg_set_error(ctx, VG_BAD_HANDLE_ERROR); + return; + } + if (glyphCount <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!glyphIndices || !is_aligned(glyphIndices)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (!adjustments_x || !is_aligned(adjustments_x) || + !adjustments_y || !is_aligned(adjustments_y)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + if (paintModes & (~(VG_STROKE_PATH|VG_FILL_PATH))) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + f = (struct vg_font*)font; + for (i = 0; i < glyphCount; ++i) { + VGuint glyph_index = glyphIndices[i]; + if (!font_contains_glyph(f, glyph_index)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + } +} + +#endif diff --git a/src/gallium/state_trackers/vega/api_transform.c b/src/gallium/state_trackers/vega/api_transform.c new file mode 100644 index 0000000000..763a5ec415 --- /dev/null +++ b/src/gallium/state_trackers/vega/api_transform.c @@ -0,0 +1,128 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" + +#include "vg_context.h" + +#include "matrix.h" + +void vgLoadIdentity(void) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat = vg_state_matrix(&ctx->state.vg); + matrix_load_identity(mat); +} + +void vgLoadMatrix(const VGfloat * m) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat; + + if (!ctx) + return; + + if (!m || !is_aligned(m)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + mat = vg_state_matrix(&ctx->state.vg); + matrix_init(mat, m); + if (!matrix_is_affine(mat)) { + if (ctx->state.vg.matrix_mode != VG_MATRIX_IMAGE_USER_TO_SURFACE) { + matrix_make_affine(mat); + } + } +} + +void vgGetMatrix(VGfloat * m) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat; + + if (!ctx) + return; + + if (!m || !is_aligned(m)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + mat = vg_state_matrix(&ctx->state.vg); + memcpy(m, mat->m, sizeof(VGfloat)*9); +} + +void vgMultMatrix(const VGfloat * m) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst, src; + + if (!ctx) + return; + + if (!m || !is_aligned(m)) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + matrix_init(&src, m); + dst = vg_state_matrix(&ctx->state.vg); + if (!matrix_is_affine(&src)) { + if (ctx->state.vg.matrix_mode != VG_MATRIX_IMAGE_USER_TO_SURFACE) { + matrix_make_affine(&src); + } + } + matrix_mult(dst, &src); + +} + +void vgTranslate(VGfloat tx, VGfloat ty) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst = vg_state_matrix(&ctx->state.vg); + matrix_translate(dst, tx, ty); +} + +void vgScale(VGfloat sx, VGfloat sy) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst = vg_state_matrix(&ctx->state.vg); + matrix_scale(dst, sx, sy); +} + +void vgShear(VGfloat shx, VGfloat shy) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst = vg_state_matrix(&ctx->state.vg); + matrix_shear(dst, shx, shy); +} + +void vgRotate(VGfloat angle) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *dst = vg_state_matrix(&ctx->state.vg); + matrix_rotate(dst, angle); +} diff --git a/src/gallium/state_trackers/vega/arc.c b/src/gallium/state_trackers/vega/arc.c new file mode 100644 index 0000000000..e74c7f0334 --- /dev/null +++ b/src/gallium/state_trackers/vega/arc.c @@ -0,0 +1,708 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "arc.h" + +#include "matrix.h" +#include "bezier.h" +#include "polygon.h" +#include "stroker.h" +#include "path.h" + +#include "util/u_debug.h" + +#include <math.h> + +#ifndef M_PI +#define M_PI 3.14159265358979323846 +#endif + +#define DEBUG_ARCS 0 + +static const VGfloat two_pi = M_PI * 2; + + +static const double coeffs3Low[2][4][4] = { + { + { 3.85268, -21.229, -0.330434, 0.0127842 }, + { -1.61486, 0.706564, 0.225945, 0.263682 }, + { -0.910164, 0.388383, 0.00551445, 0.00671814 }, + { -0.630184, 0.192402, 0.0098871, 0.0102527 } + }, + { + { -0.162211, 9.94329, 0.13723, 0.0124084 }, + { -0.253135, 0.00187735, 0.0230286, 0.01264 }, + { -0.0695069, -0.0437594, 0.0120636, 0.0163087 }, + { -0.0328856, -0.00926032, -0.00173573, 0.00527385 } + } +}; + +/* coefficients for error estimation + while using cubic Bézier curves for approximation + 1/4 <= b/a <= 1 */ +static const double coeffs3High[2][4][4] = { + { + { 0.0899116, -19.2349, -4.11711, 0.183362 }, + { 0.138148, -1.45804, 1.32044, 1.38474 }, + { 0.230903, -0.450262, 0.219963, 0.414038 }, + { 0.0590565, -0.101062, 0.0430592, 0.0204699 } + }, + { + { 0.0164649, 9.89394, 0.0919496, 0.00760802 }, + { 0.0191603, -0.0322058, 0.0134667, -0.0825018 }, + { 0.0156192, -0.017535, 0.00326508, -0.228157 }, + { -0.0236752, 0.0405821, -0.0173086, 0.176187 } + } +}; + +/* safety factor to convert the "best" error approximation + into a "max bound" error */ +static const double safety3[] = { + 0.001, 4.98, 0.207, 0.0067 +}; + +/* The code below is from the OpenVG 1.1 Spec + * Section 18.4 */ + +/* Given: Points (x0, y0) and (x1, y1) + * Return: TRUE if a solution exists, FALSE otherwise + * Circle centers are written to (cx0, cy0) and (cx1, cy1) + */ +static VGboolean +find_unit_circles(double x0, double y0, double x1, double y1, + double *cx0, double *cy0, + double *cx1, double *cy1) +{ + /* Compute differences and averages */ + double dx = x0 - x1; + double dy = y0 - y1; + double xm = (x0 + x1)/2; + double ym = (y0 + y1)/2; + double dsq, disc, s, sdx, sdy; + + /* Solve for intersecting unit circles */ + dsq = dx*dx + dy*dy; + if (dsq == 0.0) return VG_FALSE; /* Points are coincident */ + disc = 1.0/dsq - 1.0/4.0; + + /* the precision we care about here is around float so if we're + * around the float defined zero then make it official to avoid + * precision problems later on */ + if (floatIsZero(disc)) + disc = 0.0; + + if (disc < 0.0) return VG_FALSE; /* Points are too far apart */ + s = sqrt(disc); + sdx = s*dx; + sdy = s*dy; + *cx0 = xm + sdy; + *cy0 = ym - sdx; + *cx1 = xm - sdy; + *cy1 = ym + sdx; + return VG_TRUE; +} + + +/* Given: Ellipse parameters rh, rv, rot (in degrees), + * endpoints (x0, y0) and (x1, y1) + * Return: TRUE if a solution exists, FALSE otherwise + * Ellipse centers are written to (cx0, cy0) and (cx1, cy1) + */ +static VGboolean +find_ellipses(double rh, double rv, double rot, + double x0, double y0, double x1, double y1, + double *cx0, double *cy0, double *cx1, double *cy1) +{ + double COS, SIN, x0p, y0p, x1p, y1p, pcx0, pcy0, pcx1, pcy1; + /* Convert rotation angle from degrees to radians */ + rot *= M_PI/180.0; + /* Pre-compute rotation matrix entries */ + COS = cos(rot); SIN = sin(rot); + /* Transform (x0, y0) and (x1, y1) into unit space */ + /* using (inverse) rotate, followed by (inverse) scale */ + x0p = (x0*COS + y0*SIN)/rh; + y0p = (-x0*SIN + y0*COS)/rv; + x1p = (x1*COS + y1*SIN)/rh; + y1p = (-x1*SIN + y1*COS)/rv; + if (!find_unit_circles(x0p, y0p, x1p, y1p, + &pcx0, &pcy0, &pcx1, &pcy1)) { + return VG_FALSE; + } + /* Transform back to original coordinate space */ + /* using (forward) scale followed by (forward) rotate */ + pcx0 *= rh; pcy0 *= rv; + pcx1 *= rh; pcy1 *= rv; + *cx0 = pcx0*COS - pcy0*SIN; + *cy0 = pcx0*SIN + pcy0*COS; + *cx1 = pcx1*COS - pcy1*SIN; + *cy1 = pcx1*SIN + pcy1*COS; + return VG_TRUE; +} + +static INLINE VGboolean +try_to_fix_radii(struct arc *arc) +{ + double COS, SIN, rot, x0p, y0p, x1p, y1p; + double dx, dy, dsq, scale; + + /* Convert rotation angle from degrees to radians */ + rot = DEGREES_TO_RADIANS(arc->theta); + + /* Pre-compute rotation matrix entries */ + COS = cos(rot); SIN = sin(rot); + + /* Transform (x0, y0) and (x1, y1) into unit space */ + /* using (inverse) rotate, followed by (inverse) scale */ + x0p = (arc->x1*COS + arc->y1*SIN)/arc->a; + y0p = (-arc->x1*SIN + arc->y1*COS)/arc->b; + x1p = (arc->x2*COS + arc->y2*SIN)/arc->a; + y1p = (-arc->x2*SIN + arc->y2*COS)/arc->b; + /* Compute differences and averages */ + dx = x0p - x1p; + dy = y0p - y1p; + + dsq = dx*dx + dy*dy; +#if 0 + if (dsq <= 0.001) { + debug_printf("AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAaaaaa\n"); + } +#endif + scale = 1/(2/sqrt(dsq)); + arc->a *= scale; + arc->b *= scale; + return VG_TRUE; +} + +static INLINE double vector_normalize(double *v) +{ + double sq = v[0] * v[0] + v[1] * v[1]; + return sqrt(sq); +} +static INLINE double vector_orientation(double *v) +{ + double norm = vector_normalize(v); + double cosa = v[0] / norm; + double sina = v[1] / norm; + return (sina>=0 ? acos(cosa) : 2*M_PI - acos(cosa)); +} +static INLINE double vector_dot(double *v0, + double *v1) +{ + return v0[0] * v1[0] + v0[1] * v1[1]; +} + +static INLINE double vector_angles(double *v0, + double *v1) +{ + double dot = vector_dot(v0, v1); + double norm0 = vector_normalize(v0); + double norm1 = vector_normalize(v1); + + return acos(dot / (norm0 * norm1)); +} + +static VGboolean find_angles(struct arc *arc) +{ + double vec0[2], vec1[2]; + double lambda1, lambda2; + double angle; + struct matrix matrix; + + if (floatIsZero(arc->a) || floatIsZero(arc->b)) { + return VG_FALSE; + } + /* map the points to an identity circle */ + matrix_load_identity(&matrix); + matrix_scale(&matrix, 1.f, arc->a/arc->b); + matrix_rotate(&matrix, -arc->theta); + matrix_map_point(&matrix, + arc->x1, arc->y1, + &arc->x1, &arc->y1); + matrix_map_point(&matrix, + arc->x2, arc->y2, + &arc->x2, &arc->y2); + matrix_map_point(&matrix, + arc->cx, arc->cy, + &arc->cx, &arc->cy); + +#if DEBUG_ARCS + debug_printf("Matrix 3 [%f, %f, %f| %f, %f, %f| %f, %f, %f]\n", + matrix.m[0], matrix.m[1], matrix.m[2], + matrix.m[3], matrix.m[4], matrix.m[5], + matrix.m[6], matrix.m[7], matrix.m[8]); + debug_printf("Endpoints [%f, %f], [%f, %f]\n", + arc->x1, arc->y1, arc->x2, arc->y2); +#endif + + vec0[0] = arc->x1 - arc->cx; + vec0[1] = arc->y1 - arc->cy; + vec1[0] = arc->x2 - arc->cx; + vec1[1] = arc->y2 - arc->cy; + +#if DEBUG_ARCS + debug_printf("Vec is [%f, %f], [%f, %f], [%f, %f]\n", + vec0[0], vec0[1], vec1[0], vec1[1], arc->cx, arc->cy); +#endif + + lambda1 = vector_orientation(vec0); + + if (isnan(lambda1)) + lambda1 = 0.f; + + if (arc->type == VG_SCWARC_TO || + arc->type == VG_SCCWARC_TO) + angle = vector_angles(vec0, vec1); + else if (arc->type == VG_LCWARC_TO || + arc->type == VG_LCCWARC_TO) { + angle = 2*M_PI - vector_angles(vec0, vec1); + } else + abort(); + + if (isnan(angle)) + angle = M_PI; + + + if (arc->type == VG_SCWARC_TO || + arc->type == VG_LCWARC_TO) + lambda2 = lambda1 - angle; + else + lambda2 = lambda1 + angle; + +#if DEBUG_ARCS + debug_printf("Angle is %f and (%f, %f)\n", angle, lambda1, lambda2); +#endif + +#if 0 + arc->eta1 = atan2(sin(lambda1) / arc->b, + cos(lambda1) / arc->a); + arc->eta2 = atan2(sin(lambda2) / arc->b, + cos(lambda2) / arc->a); + + /* make sure we have eta1 <= eta2 <= eta1 + 2 PI */ + arc->eta2 -= two_pi * floor((arc->eta2 - arc->eta1) / two_pi); + + /* the preceding correction fails if we have exactly et2 - eta1 = 2 PI + it reduces the interval to zero length */ + if ((lambda2 - lambda1 > M_PI) && (arc->eta2 - arc->eta1 < M_PI)) { + arc->eta2 += 2 * M_PI; + } +#else + arc->eta1 = lambda1; + arc->eta2 = lambda2; +#endif + + return VG_TRUE; +} + +#if DEBUG_ARCS +static void check_endpoints(struct arc *arc) +{ + double x1, y1, x2, y2; + + double a_cos_eta1 = arc->a * cos(arc->eta1); + double b_sin_eta1 = arc->b * sin(arc->eta1); + x1 = arc->cx + a_cos_eta1 * arc->cos_theta - + b_sin_eta1 * arc->sin_theta; + y1 = arc->cy + a_cos_eta1 * arc->sin_theta + + b_sin_eta1 * arc->cos_theta; + + double a_cos_eta2 = arc->a * cos(arc->eta2); + double b_sin_eta2 = arc->b * sin(arc->eta2); + x2 = arc->cx + a_cos_eta2 * arc->cos_theta - + b_sin_eta2 * arc->sin_theta; + y2 = arc->cy + a_cos_eta2 * arc->sin_theta + + b_sin_eta2 * arc->cos_theta; + + debug_printf("Computed (%f, %f), (%f, %f)\n", + x1, y1, x2, y2); + debug_printf("Real (%f, %f), (%f, %f)\n", + arc->x1, arc->y1, + arc->x2, arc->y2); +} +#endif + +void arc_init(struct arc *arc, + VGPathSegment type, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat rh, VGfloat rv, + VGfloat rot) +{ + assert(type == VG_SCCWARC_TO || + type == VG_SCWARC_TO || + type == VG_LCCWARC_TO || + type == VG_LCWARC_TO); + arc->type = type; + arc->x1 = x1; + arc->y1 = y1; + arc->x2 = x2; + arc->y2 = y2; + arc->a = rh; + arc->b = rv; + arc->theta = rot; + arc->cos_theta = cos(arc->theta); + arc->sin_theta = sin(arc->theta); + { + double cx0, cy0, cx1, cy1; + double cx, cy; + arc->is_valid = find_ellipses(rh, rv, rot, x1, y1, x2, y2, + &cx0, &cy0, &cx1, &cy1); + + if (!arc->is_valid && try_to_fix_radii(arc)) { + rh = arc->a; + rv = arc->b; + arc->is_valid = + find_ellipses(rh, rv, rot, x1, y1, x2, y2, + &cx0, &cy0, &cx1, &cy1); + } + + if (type == VG_SCWARC_TO || + type == VG_LCCWARC_TO) { + cx = cx1; + cy = cy1; + } else { + cx = cx0; + cy = cy0; + } +#if DEBUG_ARCS + debug_printf("Centers are : (%f, %f) , (%f, %f). Real (%f, %f)\n", + cx0, cy0, cx1, cy1, cx, cy); +#endif + arc->cx = cx; + arc->cy = cy; + if (arc->is_valid) { + arc->is_valid = find_angles(arc); +#if DEBUG_ARCS + check_endpoints(arc); +#endif + /* remap a few points. find_angles requires + * rot in angles, the rest of the code + * will need them in radians. and find_angles + * modifies the center to match an identity + * circle so lets reset it */ + arc->theta = DEGREES_TO_RADIANS(rot); + arc->cos_theta = cos(arc->theta); + arc->sin_theta = sin(arc->theta); + arc->cx = cx; + arc->cy = cy; + } + } +} + +static INLINE double rational_function(double x, const double *c) +{ + return (x * (x * c[0] + c[1]) + c[2]) / (x + c[3]); +} + +static double estimate_error(struct arc *arc, + double etaA, double etaB) +{ + double eta = 0.5 * (etaA + etaB); + + double x = arc->b / arc->a; + double dEta = etaB - etaA; + double cos2 = cos(2 * eta); + double cos4 = cos(4 * eta); + double cos6 = cos(6 * eta); + double c0, c1; + + /* select the right coeficients set according to degree and b/a */ + const double (*coeffs)[4][4]; + const double *safety; + coeffs = (x < 0.25) ? coeffs3Low : coeffs3High; + safety = safety3; + + c0 = rational_function(x, coeffs[0][0]) + + cos2 * rational_function(x, coeffs[0][1]) + + cos4 * rational_function(x, coeffs[0][2]) + + cos6 * rational_function(x, coeffs[0][3]); + + c1 = rational_function(x, coeffs[1][0]) + + cos2 * rational_function(x, coeffs[1][1]) + + cos4 * rational_function(x, coeffs[1][2]) + + cos6 * rational_function(x, coeffs[1][3]); + + return rational_function(x, safety) * arc->a * exp(c0 + c1 * dEta); +} + +struct arc_cb { + void (*move)(struct arc_cb *cb, VGfloat x, VGfloat y); + void (*point)(struct arc_cb *cb, VGfloat x, VGfloat y); + void (*bezier)(struct arc_cb *cb, struct bezier *bezier); + + void *user_data; +}; + +static void cb_null_move(struct arc_cb *cb, VGfloat x, VGfloat y) +{ +} + +static void polygon_point(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct polygon *poly = (struct polygon*)cb->user_data; + polygon_vertex_append(poly, x, y); +} + +static void polygon_bezier(struct arc_cb *cb, struct bezier *bezier) +{ + struct polygon *poly = (struct polygon*)cb->user_data; + bezier_add_to_polygon(bezier, poly); +} + +static void stroke_point(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct stroker *stroker = (struct stroker*)cb->user_data; + stroker_line_to(stroker, x, y); +} + +static void stroke_curve(struct arc_cb *cb, struct bezier *bezier) +{ + struct stroker *stroker = (struct stroker*)cb->user_data; + stroker_curve_to(stroker, + bezier->x2, bezier->y2, + bezier->x3, bezier->y3, + bezier->x4, bezier->y4); +} + +static void stroke_emit_point(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct stroker *stroker = (struct stroker*)cb->user_data; + stroker_emit_line_to(stroker, x, y); +} + +static void stroke_emit_curve(struct arc_cb *cb, struct bezier *bezier) +{ + struct stroker *stroker = (struct stroker*)cb->user_data; + stroker_emit_curve_to(stroker, + bezier->x2, bezier->y2, + bezier->x3, bezier->y3, + bezier->x4, bezier->y4); +} + +static void arc_path_move(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct path *path = (struct path*)cb->user_data; + path_move_to(path, x, y); +} + +static void arc_path_point(struct arc_cb *cb, VGfloat x, VGfloat y) +{ + struct path *path = (struct path*)cb->user_data; + path_line_to(path, x, y); +} + +static void arc_path_bezier(struct arc_cb *cb, struct bezier *bezier) +{ + struct path *path = (struct path*)cb->user_data; + path_cubic_to(path, + bezier->x2, bezier->y2, + bezier->x3, bezier->y3, + bezier->x4, bezier->y4); +} + +static INLINE int num_beziers_needed(struct arc *arc) +{ + double threshold = 0.05; + VGboolean found = VG_FALSE; + int n = 1; + double min_eta, max_eta; + + min_eta = MIN2(arc->eta1, arc->eta2); + max_eta = MAX2(arc->eta1, arc->eta2); + + while ((! found) && (n < 1024)) { + double d_eta = (max_eta - min_eta) / n; + if (d_eta <= 0.5 * M_PI) { + double eta_b = min_eta; + found = VG_TRUE; + for (int i = 0; found && (i < n); ++i) { + double etaA = eta_b; + eta_b += d_eta; + found = (estimate_error(arc, etaA, eta_b) <= threshold); + } + } + n = n << 1; + } + + return n; +} + +static void arc_to_beziers(struct arc *arc, + struct arc_cb cb, + struct matrix *matrix) +{ + int n = 1; + double d_eta, eta_b, cos_eta_b, + sin_eta_b, a_cos_eta_b, b_sin_eta_b, a_sin_eta_b, + b_cos_eta_b, x_b, y_b, x_b_dot, y_b_dot, lx, ly; + double t, alpha; + + { /* always move to the start of the arc */ + VGfloat x = arc->x1; + VGfloat y = arc->y1; + matrix_map_point(matrix, x, y, &x, &y); + cb.move(&cb, x, y); + } + + if (!arc->is_valid) { + VGfloat x = arc->x2; + VGfloat y = arc->y2; + matrix_map_point(matrix, x, y, &x, &y); + cb.point(&cb, x, y); + return; + } + + /* find the number of Bézier curves needed */ + n = num_beziers_needed(arc); + + d_eta = (arc->eta2 - arc->eta1) / n; + eta_b = arc->eta1; + + cos_eta_b = cos(eta_b); + sin_eta_b = sin(eta_b); + a_cos_eta_b = arc->a * cos_eta_b; + b_sin_eta_b = arc->b * sin_eta_b; + a_sin_eta_b = arc->a * sin_eta_b; + b_cos_eta_b = arc->b * cos_eta_b; + x_b = arc->cx + a_cos_eta_b * arc->cos_theta - + b_sin_eta_b * arc->sin_theta; + y_b = arc->cy + a_cos_eta_b * arc->sin_theta + + b_sin_eta_b * arc->cos_theta; + x_b_dot = -a_sin_eta_b * arc->cos_theta - + b_cos_eta_b * arc->sin_theta; + y_b_dot = -a_sin_eta_b * arc->sin_theta + + b_cos_eta_b * arc->cos_theta; + + { + VGfloat x = x_b, y = y_b; + matrix_map_point(matrix, x, y, &x, &y); + cb.point(&cb, x, y); + } + lx = x_b; + ly = y_b; + + t = tan(0.5 * d_eta); + alpha = sin(d_eta) * (sqrt(4 + 3 * t * t) - 1) / 3; + + for (int i = 0; i < n; ++i) { + struct bezier bezier; + double xA = x_b; + double yA = y_b; + double xADot = x_b_dot; + double yADot = y_b_dot; + + eta_b += d_eta; + cos_eta_b = cos(eta_b); + sin_eta_b = sin(eta_b); + a_cos_eta_b = arc->a * cos_eta_b; + b_sin_eta_b = arc->b * sin_eta_b; + a_sin_eta_b = arc->a * sin_eta_b; + b_cos_eta_b = arc->b * cos_eta_b; + x_b = arc->cx + a_cos_eta_b * arc->cos_theta - + b_sin_eta_b * arc->sin_theta; + y_b = arc->cy + a_cos_eta_b * arc->sin_theta + + b_sin_eta_b * arc->cos_theta; + x_b_dot = -a_sin_eta_b * arc->cos_theta - + b_cos_eta_b * arc->sin_theta; + y_b_dot = -a_sin_eta_b * arc->sin_theta + + b_cos_eta_b * arc->cos_theta; + + bezier_init(&bezier, + lx, ly, + (float) (xA + alpha * xADot), (float) (yA + alpha * yADot), + (float) (x_b - alpha * x_b_dot), (float) (y_b - alpha * y_b_dot), + (float) x_b, (float) y_b); +#if 0 + debug_printf("%d) Bezier (%f, %f), (%f, %f), (%f, %f), (%f, %f)\n", + i, + bezier.x1, bezier.y1, + bezier.x2, bezier.y2, + bezier.x3, bezier.y3, + bezier.x4, bezier.y4); +#endif + bezier_transform(&bezier, matrix); + cb.bezier(&cb, &bezier); + lx = x_b; + ly = y_b; + } +} + + +void arc_add_to_polygon(struct arc *arc, + struct polygon *poly, + struct matrix *matrix) +{ + struct arc_cb cb; + + cb.move = cb_null_move; + cb.point = polygon_point; + cb.bezier = polygon_bezier; + cb.user_data = poly; + + arc_to_beziers(arc, cb, matrix); +} + +void arc_stroke_cb(struct arc *arc, + struct stroker *stroke, + struct matrix *matrix) +{ + struct arc_cb cb; + + cb.move = cb_null_move; + cb.point = stroke_point; + cb.bezier = stroke_curve; + cb.user_data = stroke; + + arc_to_beziers(arc, cb, matrix); +} + +void arc_stroker_emit(struct arc *arc, + struct stroker *stroker, + struct matrix *matrix) +{ + struct arc_cb cb; + + cb.move = cb_null_move; + cb.point = stroke_emit_point; + cb.bezier = stroke_emit_curve; + cb.user_data = stroker; + + arc_to_beziers(arc, cb, matrix); +} + +void arc_to_path(struct arc *arc, + struct path *path, + struct matrix *matrix) +{ + struct arc_cb cb; + + cb.move = arc_path_move; + cb.point = arc_path_point; + cb.bezier = arc_path_bezier; + cb.user_data = path; + + arc_to_beziers(arc, cb, matrix); +} diff --git a/src/gallium/state_trackers/vega/arc.h b/src/gallium/state_trackers/vega/arc.h new file mode 100644 index 0000000000..3205cd5021 --- /dev/null +++ b/src/gallium/state_trackers/vega/arc.h @@ -0,0 +1,80 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef ARC_H +#define ARC_H + +#include "VG/openvg.h" + +struct polygon; +struct matrix; +struct stroker; +struct path; + +struct arc { + VGPathSegment type; + + VGfloat cx, cy; + + VGfloat a, b; + + VGfloat theta; + VGfloat cos_theta, sin_theta; + + VGfloat eta1; + VGfloat eta2; + + VGfloat x1, y1, x2, y2; + + VGboolean is_valid; +}; + +void arc_init(struct arc *arc, + VGPathSegment type, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat rh, VGfloat rv, + VGfloat rot); + +void arc_add_to_polygon(struct arc *arc, + struct polygon *poly, + struct matrix *matrix); + + +void arc_to_path(struct arc *arc, + struct path *p, + struct matrix *matrix); + +void arc_stroke_cb(struct arc *arc, + struct stroker *stroke, + struct matrix *matrix); + +void arc_stroker_emit(struct arc *arc, + struct stroker *stroke, + struct matrix *matrix); + + +#endif diff --git a/src/gallium/state_trackers/vega/asm_fill.h b/src/gallium/state_trackers/vega/asm_fill.h new file mode 100644 index 0000000000..2f394ad6c5 --- /dev/null +++ b/src/gallium/state_trackers/vega/asm_fill.h @@ -0,0 +1,246 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef ASM_FILL_H +#define ASM_FILL_H + +static const char solid_fill_asm[] = + "MOV %s, CONST[0]\n"; + + +static const char linear_grad_asm[] = + "MOV TEMP[0].xy, IN[0]\n" + "MOV TEMP[0].z, CONST[1].yyyy\n" + "DP3 TEMP[1], CONST[2], TEMP[0]\n" + "DP3 TEMP[2], CONST[3], TEMP[0]\n" + "DP3 TEMP[3], CONST[4], TEMP[0]\n" + "RCP TEMP[3], TEMP[3]\n" + "MUL TEMP[1], TEMP[1], TEMP[3]\n" + "MUL TEMP[2], TEMP[2], TEMP[3]\n" + "MOV TEMP[4].x, TEMP[1]\n" + "MOV TEMP[4].y, TEMP[2]\n" + "MUL TEMP[0], CONST[0].yyyy, TEMP[4].yyyy\n" + "MAD TEMP[1], CONST[0].xxxx, TEMP[4].xxxx, TEMP[0]\n" + "MUL TEMP[2], TEMP[1], CONST[0].zzzz\n" + "TEX %s, TEMP[2], SAMP[0], 1D\n"; + +static const char radial_grad_asm[] = + "MOV TEMP[0].xy, IN[0]\n" + "MOV TEMP[0].z, CONST[1].yyyy\n" + "DP3 TEMP[1], CONST[2], TEMP[0]\n" + "DP3 TEMP[2], CONST[3], TEMP[0]\n" + "DP3 TEMP[3], CONST[4], TEMP[0]\n" + "RCP TEMP[3], TEMP[3]\n" + "MUL TEMP[1], TEMP[1], TEMP[3]\n" + "MUL TEMP[2], TEMP[2], TEMP[3]\n" + "MOV TEMP[5].x, TEMP[1]\n" + "MOV TEMP[5].y, TEMP[2]\n" + "MUL TEMP[0], CONST[0].yyyy, TEMP[5].yyyy\n" + "MAD TEMP[1], CONST[0].xxxx, TEMP[5].xxxx, TEMP[0]\n" + "ADD TEMP[1], TEMP[1], TEMP[1]\n" + "MUL TEMP[3], TEMP[5].yyyy, TEMP[5].yyyy\n" + "MAD TEMP[4], TEMP[5].xxxx, TEMP[5].xxxx, TEMP[3]\n" + "MOV TEMP[4], -TEMP[4]\n" + "MUL TEMP[2], CONST[0].zzzz, TEMP[4]\n" + "MUL TEMP[0], CONST[1].wwww, TEMP[2]\n" + "MUL TEMP[3], TEMP[1], TEMP[1]\n" + "SUB TEMP[2], TEMP[3], TEMP[0]\n" + "RSQ TEMP[2], |TEMP[2]|\n" + "RCP TEMP[2], TEMP[2]\n" + "SUB TEMP[1], TEMP[2], TEMP[1]\n" + "ADD TEMP[0], CONST[0].zzzz, CONST[0].zzzz\n" + "RCP TEMP[0], TEMP[0]\n" + "MUL TEMP[2], TEMP[1], TEMP[0]\n" + "TEX %s, TEMP[2], SAMP[0], 1D\n"; + +static const char pattern_asm[] = + "MOV TEMP[0].xy, IN[0]\n" + "MOV TEMP[0].z, CONST[1].yyyy\n" + "DP3 TEMP[1], CONST[2], TEMP[0]\n" + "DP3 TEMP[2], CONST[3], TEMP[0]\n" + "DP3 TEMP[3], CONST[4], TEMP[0]\n" + "RCP TEMP[3], TEMP[3]\n" + "MUL TEMP[1], TEMP[1], TEMP[3]\n" + "MUL TEMP[2], TEMP[2], TEMP[3]\n" + "MOV TEMP[4].x, TEMP[1]\n" + "MOV TEMP[4].y, TEMP[2]\n" + "RCP TEMP[0], CONST[1].zwzw\n" + "MOV TEMP[1], TEMP[4]\n" + "MUL TEMP[1].x, TEMP[1], TEMP[0]\n" + "MUL TEMP[1].y, TEMP[1], TEMP[0]\n" + "TEX %s, TEMP[1], SAMP[0], 2D\n"; + + +static const char mask_asm[] = + "TEX TEMP[1], IN[0], SAMP[1], 2D\n" + "MUL TEMP[0].w, TEMP[0].wwww, TEMP[1].wwww\n" + "MOV %s, TEMP[0]\n"; + + +static const char image_normal_asm[] = + "TEX %s, IN[1], SAMP[3], 2D\n"; + +static const char image_multiply_asm[] = + "TEX TEMP[1], IN[1], SAMP[3], 2D\n" + "MUL %s, TEMP[0], TEMP[1]\n"; + +static const char image_stencil_asm[] = + "TEX TEMP[1], IN[1], SAMP[3], 2D\n" + "MUL %s, TEMP[0], TEMP[1]\n"; + + +#define EXTENDED_BLEND_OVER \ + "SUB TEMP[3], CONST[1].yyyy, TEMP[1].wwww\n" \ + "SUB TEMP[4], CONST[1].yyyy, TEMP[0].wwww\n" \ + "MUL TEMP[3], TEMP[0], TEMP[3]\n" \ + "MUL TEMP[4], TEMP[1], TEMP[4]\n" \ + "ADD TEMP[3], TEMP[3], TEMP[4]\n" + +static const char blend_multiply_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + EXTENDED_BLEND_OVER + "MUL TEMP[4], TEMP[0], TEMP[1]\n" + "ADD TEMP[1], TEMP[4], TEMP[3]\n"/*result.rgb*/ + "MUL TEMP[2], TEMP[0].wwww, TEMP[1].wwww\n" + "ADD TEMP[3], TEMP[0].wwww, TEMP[1].wwww\n" + "SUB TEMP[1].w, TEMP[3], TEMP[2]\n" + "MOV %s, TEMP[1]\n"; +#if 1 +static const char blend_screen_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + "ADD TEMP[3], TEMP[0], TEMP[1]\n" + "MUL TEMP[2], TEMP[0], TEMP[1]\n" + "SUB %s, TEMP[3], TEMP[2]\n"; +#else +static const char blend_screen_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + "MOV %s, TEMP[1]\n"; +#endif + +static const char blend_darken_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + EXTENDED_BLEND_OVER + "MUL TEMP[4], TEMP[0], TEMP[1].wwww\n" + "MUL TEMP[5], TEMP[1], TEMP[0].wwww\n" + "MIN TEMP[4], TEMP[4], TEMP[5]\n" + "ADD TEMP[1], TEMP[3], TEMP[4]\n" + "MUL TEMP[2], TEMP[0].wwww, TEMP[1].wwww\n" + "ADD TEMP[3], TEMP[0].wwww, TEMP[1].wwww\n" + "SUB TEMP[1].w, TEMP[3], TEMP[2]\n" + "MOV %s, TEMP[1]\n"; + +static const char blend_lighten_asm[] = + "TEX TEMP[1], IN[0], SAMP[2], 2D\n" + EXTENDED_BLEND_OVER + "MUL TEMP[4], TEMP[0], TEMP[1].wwww\n" + "MUL TEMP[5], TEMP[1], TEMP[0].wwww\n" + "MAX TEMP[4], TEMP[4], TEMP[5]\n" + "ADD TEMP[1], TEMP[3], TEMP[4]\n" + "MUL TEMP[2], TEMP[0].wwww, TEMP[1].wwww\n" + "ADD TEMP[3], TEMP[0].wwww, TEMP[1].wwww\n" + "SUB TEMP[1].w, TEMP[3], TEMP[2]\n" + "MOV %s, TEMP[1]\n"; + + +static const char premultiply_asm[] = + "MUL TEMP[0].xyz, TEMP[0], TEMP[0].wwww\n"; + +static const char unpremultiply_asm[] = + "TEX TEMP[0], IN[0], SAMP[1], 2D\n"; + + +static const char color_bw_asm[] = + "ADD TEMP[1], CONST[1].yyyy, CONST[1].yyyy\n" + "RCP TEMP[2], TEMP[1]\n" + "ADD TEMP[1], CONST[1].yyyy, TEMP[2]\n" + "ADD TEMP[2].x, TEMP[0].xxxx, TEMP[0].yyyy\n" + "ADD TEMP[2].x, TEMP[0].zzzz, TEMP[0].xxxx\n" + "SGE TEMP[0].xyz, TEMP[2].xxxx, TEMP[1]\n" + "SGE TEMP[0].w, TEMP[0].wwww, TEMP[2].yyyy\n" + "MOV %s, TEMP[0]\n"; + + +struct shader_asm_info { + VGint id; + VGint num_tokens; + const char * txt; + + VGboolean needs_position; + + VGint start_const; + VGint num_consts; + + VGint start_sampler; + VGint num_samplers; + + VGint start_temp; + VGint num_temps; +}; + + +static const struct shader_asm_info shaders_asm[] = { + /* fills */ + {VEGA_SOLID_FILL_SHADER, 40, solid_fill_asm, + VG_FALSE, 0, 1, 0, 0, 0, 0}, + {VEGA_LINEAR_GRADIENT_SHADER, 200, linear_grad_asm, + VG_TRUE, 0, 5, 0, 1, 0, 5}, + {VEGA_RADIAL_GRADIENT_SHADER, 200, radial_grad_asm, + VG_TRUE, 0, 5, 0, 1, 0, 6}, + {VEGA_PATTERN_SHADER, 100, pattern_asm, + VG_TRUE, 1, 4, 0, 1, 0, 5}, + + /* image draw modes */ + {VEGA_IMAGE_NORMAL_SHADER, 200, image_normal_asm, + VG_TRUE, 0, 0, 3, 1, 0, 0}, + {VEGA_IMAGE_MULTIPLY_SHADER, 200, image_multiply_asm, + VG_TRUE, 0, 0, 3, 1, 0, 2}, + {VEGA_IMAGE_STENCIL_SHADER, 200, image_stencil_asm, + VG_TRUE, 0, 0, 3, 1, 0, 2}, + + {VEGA_MASK_SHADER, 100, mask_asm, + VG_TRUE, 0, 0, 1, 1, 0, 2}, + + /* extra blend modes */ + {VEGA_BLEND_MULTIPLY_SHADER, 200, blend_multiply_asm, + VG_TRUE, 1, 1, 2, 1, 0, 5}, + {VEGA_BLEND_SCREEN_SHADER, 200, blend_screen_asm, + VG_TRUE, 0, 0, 2, 1, 0, 4}, + {VEGA_BLEND_DARKEN_SHADER, 200, blend_darken_asm, + VG_TRUE, 1, 1, 2, 1, 0, 6}, + {VEGA_BLEND_LIGHTEN_SHADER, 200, blend_lighten_asm, + VG_TRUE, 1, 1, 2, 1, 0, 6}, + + /* premultiply */ + {VEGA_PREMULTIPLY_SHADER, 100, premultiply_asm, + VG_FALSE, 0, 0, 0, 0, 0, 1}, + {VEGA_UNPREMULTIPLY_SHADER, 100, unpremultiply_asm, + VG_FALSE, 0, 0, 0, 0, 0, 1}, + + /* color transform to black and white */ + {VEGA_BW_SHADER, 150, color_bw_asm, + VG_FALSE, 1, 1, 0, 0, 0, 3}, +}; +#endif diff --git a/src/gallium/state_trackers/vega/asm_filters.h b/src/gallium/state_trackers/vega/asm_filters.h new file mode 100644 index 0000000000..49807b9ab4 --- /dev/null +++ b/src/gallium/state_trackers/vega/asm_filters.h @@ -0,0 +1,117 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef ASM_FILTERS_H +#define ASM_FILTERS_H + +static const char color_matrix_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL CONST[0..4], CONSTANT\n" + "DCL TEMP[0..4], CONSTANT\n" + "DCL SAMP[0], CONSTANT\n" + "TEX TEMP[0], IN[0], SAMP[0], 2D\n" + "MOV TEMP[1], TEMP[0].xxxx\n" + "MOV TEMP[2], TEMP[0].yyyy\n" + "MOV TEMP[3], TEMP[0].zzzz\n" + "MOV TEMP[4], TEMP[0].wwww\n" + "MUL TEMP[1], TEMP[1], CONST[0]\n" + "MUL TEMP[2], TEMP[2], CONST[1]\n" + "MUL TEMP[3], TEMP[3], CONST[2]\n" + "MUL TEMP[4], TEMP[4], CONST[3]\n" + "ADD TEMP[0], TEMP[1], CONST[4]\n" + "ADD TEMP[0], TEMP[0], TEMP[2]\n" + "ADD TEMP[0], TEMP[0], TEMP[3]\n" + "ADD TEMP[0], TEMP[0], TEMP[4]\n" + "MOV OUT[0], TEMP[0]\n" + "END\n"; + +static const char convolution_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL TEMP[0..4], CONSTANT\n" + "DCL ADDR[0], CONSTANT\n" + "DCL CONST[0..%d], CONSTANT\n" + "DCL SAMP[0], CONSTANT\n" + "0: MOV TEMP[0], CONST[0].xxxx\n" + "1: MOV TEMP[1], CONST[0].xxxx\n" + "2: BGNLOOP2 :14\n" + "3: SGE TEMP[0].z, TEMP[0].yyyy, CONST[1].xxxx\n" + "4: IF TEMP[0].zzzz :7\n" + "5: BRK\n" + "6: ENDIF\n" + "7: ARL ADDR[0].x, TEMP[0].yyyy\n" + "8: MOV TEMP[3], CONST[ADDR[0]+2]\n" + "9: ADD TEMP[4].xy, IN[0], TEMP[3]\n" + "10: TEX TEMP[2], TEMP[4], SAMP[0], 2D\n" + "11: MOV TEMP[3], CONST[ADDR[0]+%d]\n" + "12: MAD TEMP[1], TEMP[2], TEMP[3], TEMP[1]\n" + "13: ADD TEMP[0].y, TEMP[0].yyyy, CONST[0].yyyy\n" + "14: ENDLOOP2 :2\n" + "15: MAD OUT[0], TEMP[1], CONST[1].yyyy, CONST[1].zzzz\n" + "16: END\n"; + + +static const char lookup_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL TEMP[0..2], CONSTANT\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "TEX TEMP[0], IN[0], SAMP[0], 2D\n" + "MOV TEMP[1], TEMP[0]\n" + /* do red */ + "TEX TEMP[2], TEMP[1].xxxx, SAMP[1], 1D\n" + "MOV TEMP[0].x, TEMP[2].xxxx\n" + /* do blue */ + "TEX TEMP[2], TEMP[1].yyyy, SAMP[1], 1D\n" + "MOV TEMP[0].y, TEMP[2].yyyy\n" + /* do green */ + "TEX TEMP[2], TEMP[1].zzzz, SAMP[1], 1D\n" + "MOV TEMP[0].z, TEMP[2].zzzz\n" + /* do alpha */ + "TEX TEMP[2], TEMP[1].wwww, SAMP[1], 1D\n" + "MOV TEMP[0].w, TEMP[2].wwww\n" + "MOV OUT[0], TEMP[0]\n" + "END\n"; + + +static const char lookup_single_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL TEMP[0..2], CONSTANT\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "TEX TEMP[0], IN[0], SAMP[0], 2D\n" + "TEX TEMP[1], TEMP[0].%s, SAMP[1], 1D\n" + "MOV OUT[0], TEMP[1]\n" + "END\n"; + +#endif diff --git a/src/gallium/state_trackers/vega/asm_util.h b/src/gallium/state_trackers/vega/asm_util.h new file mode 100644 index 0000000000..218e1d166d --- /dev/null +++ b/src/gallium/state_trackers/vega/asm_util.h @@ -0,0 +1,136 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef ASM_UTIL_H +#define ASM_UTIL_H + + +static const char pass_through_depth_asm[] = + "FRAG1.1\n" + "DCL IN[0], POSITION, LINEAR\n" + "DCL OUT[0].z, POSITION, CONSTANT\n" + "0: MOV OUT[0].z, IN[0].zzzz\n" + "1: END\n"; + + + +/* μnew = μmask */ +static const char set_mask_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL SAMP[0], CONSTANT\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "0: TEX OUT[0], IN[0], SAMP[0], 2D\n"/*umask*/ + "1: END\n"; + +/* μnew = 1 – (1 – μmask)*(1 – μprev) */ +static const char union_mask_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL IN[1], POSITION, LINEAR\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "DCL TEMP[0..3], CONSTANT\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "0: TEX TEMP[1], IN[0], SAMP[0], 2D\n"/*umask*/ + "1: TEX TEMP[0], IN[1], SAMP[1], 2D\n"/*uprev*/ + "2: SUB TEMP[2], CONST[0], TEMP[0]\n" + "3: SUB TEMP[3], CONST[0], TEMP[1]\n" + "4: MUL TEMP[0].w, TEMP[2].wwww, TEMP[3].wwww\n" + "5: SUB OUT[0], CONST[0], TEMP[0]\n" + "6: END\n"; + +/* μnew = μmask *μprev */ +static const char intersect_mask_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL IN[1], POSITION, LINEAR\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "DCL TEMP[0..1], CONSTANT\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "0: TEX TEMP[0], IN[1], SAMP[1], 2D\n"/*uprev*/ + "1: TEX TEMP[1], IN[0], SAMP[0], 2D\n"/*umask*/ + "2: MUL OUT[0], TEMP[0].wwww, TEMP[1].wwww\n" + "3: END\n"; + +/* μnew = μprev*(1 – μmask) */ +static const char subtract_mask_asm[] = + "FRAG1.1\n" + "DCL IN[0], GENERIC[0], PERSPECTIVE\n" + "DCL IN[1], POSITION, LINEAR\n" + "DCL CONST[0], CONSTANT\n" + "DCL SAMP[0..1], CONSTANT\n" + "DCL TEMP[0..2], CONSTANT\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "0: TEX TEMP[1], IN[0], SAMP[0], 2D\n"/*umask*/ + "1: TEX TEMP[0], IN[1], SAMP[1], 2D\n"/*uprev*/ + "2: SUB TEMP[2], CONST[0], TEMP[1]\n" + "3: MUL OUT[0], TEMP[2].wwww, TEMP[0].wwww\n" + "4: END\n"; + + +static const char vs_plain_asm[] = + "VERT1.1\n" + "DCL IN[0]\n" + "DCL OUT[0], POSITION\n" + "DCL TEMP[0]\n" + "DCL CONST[0..1]\n" + "0: MUL TEMP[0], IN[0], CONST[0]\n" + "1: ADD TEMP[0], TEMP[0], CONST[1]\n" + "2: MOV OUT[0], TEMP[0]\n" + "3: END\n"; + +static const char vs_clear_asm[] = + "VERT1.1\n" + "DCL IN[0]\n" + "DCL IN[1]\n" + "DCL OUT[0], POSITION\n" + "DCL OUT[1], COLOR\n" + "DCL TEMP[0]\n" + "DCL CONST[0..1]\n" + "0: MUL TEMP[0], IN[0], CONST[0]\n" + "1: ADD TEMP[0], TEMP[0], CONST[1]\n" + "2: MOV OUT[0], TEMP[0]\n" + "3: MOV OUT[1], IN[1]\n" + "4: END\n"; + + +static const char vs_texture_asm[] = + "VERT1.1\n" + "DCL IN[0]\n" + "DCL IN[1]\n" + "DCL OUT[0], POSITION\n" + "DCL OUT[1], GENERIC\n" + "DCL TEMP[0]\n" + "DCL CONST[0..1]\n" + "0: MUL TEMP[0], IN[0], CONST[0]\n" + "1: ADD TEMP[0], TEMP[0], CONST[1]\n" + "2: MOV OUT[0], TEMP[0]\n" + "3: MOV OUT[1], IN[1]\n" + "4: END\n"; + +#endif diff --git a/src/gallium/state_trackers/vega/bezier.c b/src/gallium/state_trackers/vega/bezier.c new file mode 100644 index 0000000000..39a7ade016 --- /dev/null +++ b/src/gallium/state_trackers/vega/bezier.c @@ -0,0 +1,704 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "bezier.h" + +#include "matrix.h" +#include "polygon.h" + +#include "pipe/p_compiler.h" +#include "util/u_debug.h" + +#include <stdlib.h> +#include <stdio.h> +#include <assert.h> +#include <math.h> + +static const float flatness = 0.5; + + +static INLINE void split_left(struct bezier *bez, VGfloat t, struct bezier* left) +{ + left->x1 = bez->x1; + left->y1 = bez->y1; + + left->x2 = bez->x1 + t * (bez->x2 - bez->x1); + left->y2 = bez->y1 + t * (bez->y2 - bez->y1); + + left->x3 = bez->x2 + t * (bez->x3 - bez->x2); + left->y3 = bez->y2 + t * (bez->y3 - bez->y2); + + bez->x3 = bez->x3 + t * (bez->x4 - bez->x3); + bez->y3 = bez->y3 + t * (bez->y4 - bez->y3); + + bez->x2 = left->x3 + t * (bez->x3 - left->x3); + bez->y2 = left->y3 + t * (bez->y3 - left->y3); + + left->x3 = left->x2 + t * (left->x3 - left->x2); + left->y3 = left->y2 + t * (left->y3 - left->y2); + + left->x4 = bez->x1 = left->x3 + t * (bez->x2 - left->x3); + left->y4 = bez->y1 = left->y3 + t * (bez->y2 - left->y3); +} + +static INLINE void split(struct bezier *bez, + struct bezier *first_half, + struct bezier *second_half) +{ + double c = (bez->x2 + bez->x3) * 0.5; + first_half->x2 = (bez->x1 + bez->x2) * 0.5; + second_half->x3 = (bez->x3 + bez->x4) * 0.5; + first_half->x1 = bez->x1; + second_half->x4 = bez->x4; + first_half->x3 = (first_half->x2 + c) * 0.5; + second_half->x2 = (second_half->x3 + c) * 0.5; + first_half->x4 = second_half->x1 = + (first_half->x3 + second_half->x2) * 0.5; + + c = (bez->y2 + bez->y3) / 2; + first_half->y2 = (bez->y1 + bez->y2) * 0.5; + second_half->y3 = (bez->y3 + bez->y4) * 0.5; + first_half->y1 = bez->y1; + second_half->y4 = bez->y4; + first_half->y3 = (first_half->y2 + c) * 0.5; + second_half->y2 = (second_half->y3 + c) * 0.5; + first_half->y4 = second_half->y1 = + (first_half->y3 + second_half->y2) * 0.5; +} + +struct polygon * bezier_to_polygon(struct bezier *bez) +{ + struct polygon *poly = polygon_create(64); + polygon_vertex_append(poly, bez->x1, bez->y1); + bezier_add_to_polygon(bez, poly); + return poly; +} + +void bezier_add_to_polygon(const struct bezier *bez, + struct polygon *poly) +{ + struct bezier beziers[32]; + struct bezier *b; + + beziers[0] = *bez; + b = beziers; + + while (b >= beziers) { + double y4y1 = b->y4 - b->y1; + double x4x1 = b->x4 - b->x1; + double l = ABS(x4x1) + ABS(y4y1); + double d; + if (l > 1.f) { + d = ABS((x4x1)*(b->y1 - b->y2) - (y4y1)*(b->x1 - b->x2)) + + ABS((x4x1)*(b->y1 - b->y3) - (y4y1)*(b->x1 - b->x3)); + } else { + d = ABS(b->x1 - b->x2) + ABS(b->y1 - b->y2) + + ABS(b->x1 - b->x3) + ABS(b->y1 - b->y3); + l = 1.; + } + if (d < flatness*l || b == beziers + 31) { + /* good enough, we pop it off and add the endpoint */ + polygon_vertex_append(poly, b->x4, b->y4); + --b; + } else { + /* split, second half of the bezier goes lower into the stack */ + split(b, b+1, b); + ++b; + } + } +} + +static void add_if_close(struct bezier *bez, VGfloat *length, VGfloat error) +{ + struct bezier left, right; /* bez poly splits */ + VGfloat len = 0.0; /* arc length */ + VGfloat chord; /* chord length */ + + len = len + line_length(bez->x1, bez->y1, bez->x2, bez->y2); + len = len + line_length(bez->x2, bez->y2, bez->x3, bez->y3); + len = len + line_length(bez->x3, bez->y3, bez->x4, bez->y4); + + chord = line_length(bez->x1, bez->y1, bez->x4, bez->y4); + + if ((len-chord) > error) { + split(bez, &left, &right); /* split in two */ + add_if_close(&left, length, error); /* try left side */ + add_if_close(&right, length, error); /* try right side */ + return; + } + + *length = *length + len; + + return; +} + +float bezier_length(struct bezier *bez, float error) +{ + VGfloat length = 0.f; + + add_if_close(bez, &length, error); + return length; +} + +void bezier_init(struct bezier *bez, + float x1, float y1, + float x2, float y2, + float x3, float y3, + float x4, float y4) +{ + bez->x1 = x1; + bez->y1 = y1; + bez->x2 = x2; + bez->y2 = y2; + bez->x3 = x3; + bez->y3 = y3; + bez->x4 = x4; + bez->y4 = y4; +#if 0 + debug_printf("bezier in [%f, %f, %f, %f, %f, %f]\n", + x1, y1, x2, y2, x3, y3, x4, y4); +#endif +} + + +static INLINE void bezier_init2v(struct bezier *bez, + float *pt1, + float *pt2, + float *pt3, + float *pt4) +{ + bez->x1 = pt1[0]; + bez->y1 = pt1[1]; + + bez->x2 = pt2[0]; + bez->y2 = pt2[1]; + + bez->x3 = pt3[0]; + bez->y3 = pt3[1]; + + bez->x4 = pt4[0]; + bez->y4 = pt4[1]; +} + + +void bezier_transform(struct bezier *bez, + struct matrix *matrix) +{ + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, bez->x1, bez->y1, &bez->x1, &bez->y1); + matrix_map_point(matrix, bez->x2, bez->y2, &bez->x2, &bez->y2); + matrix_map_point(matrix, bez->x3, bez->y3, &bez->x3, &bez->y3); + matrix_map_point(matrix, bez->x4, bez->y4, &bez->x4, &bez->y4); +} + +static INLINE void bezier_point_at(const struct bezier *bez, float t, float *pt) +{ + float a, b, c, d; + float m_t; + m_t = 1. - t; + b = m_t * m_t; + c = t * t; + d = c * t; + a = b * m_t; + b *= 3. * t; + c *= 3. * m_t; + pt[0] = a*bez->x1 + b*bez->x2 + c*bez->x3 + d*bez->x4; + pt[1] = a*bez->y1 + b*bez->y2 + c*bez->y3 + d*bez->y4; +} + +static INLINE void bezier_normal_at(const struct bezier *bez, float t, float *norm) +{ + float m_t = 1. - t; + float a = m_t * m_t; + float b = t * m_t; + float c = t * t; + + norm[0] = (bez->y2-bez->y1) * a + (bez->y3-bez->y2) * b + (bez->y4-bez->y3) * c; + norm[1] = -(bez->x2-bez->x1) * a - (bez->x3-bez->x2) * b - (bez->x4-bez->x3) * c; +} + +enum shift_result { + Ok, + Discard, + Split, + Circle +}; + +static enum shift_result good_offset(const struct bezier *b1, + const struct bezier *b2, + float offset, float threshold) +{ + const float o2 = offset*offset; + const float max_dist_line = threshold*offset*offset; + const float max_dist_normal = threshold*offset; + const float spacing = 0.25; + for (float i = spacing; i < 0.99; i += spacing) { + float p1[2],p2[2], d, l; + float normal[2]; + bezier_point_at(b1, i, p1); + bezier_point_at(b2, i, p2); + d = (p1[0] - p2[0])*(p1[0] - p2[0]) + (p1[1] - p2[1])*(p1[1] - p2[1]); + if (ABS(d - o2) > max_dist_line) + return Split; + + bezier_normal_at(b1, i, normal); + l = ABS(normal[0]) + ABS(normal[1]); + if (l != 0.) { + d = ABS(normal[0]*(p1[1] - p2[1]) - normal[1]*(p1[0] - p2[0]) ) / l; + if (d > max_dist_normal) + return Split; + } + } + return Ok; +} + +static INLINE void shift_line_by_normal(float *l, float offset) +{ + float norm[4]; + float tx, ty; + + line_normal(l, norm); + line_normalize(norm); + + tx = (norm[2] - norm[0]) * offset; + ty = (norm[3] - norm[1]) * offset; + l[0] += tx; l[1] += ty; + l[2] += tx; l[3] += ty; +} + +static INLINE VGboolean is_bezier_line(float (*points)[2], int count) +{ + float dx13 = points[2][0] - points[0][0]; + float dy13 = points[2][1] - points[0][1]; + + float dx12 = points[1][0] - points[0][0]; + float dy12 = points[1][1] - points[0][1]; + + debug_assert(count > 2); + + if (count == 3) { + return floatsEqual(dx12 * dy13, dx13 * dy12); + } else if (count == 4) { + float dx14 = points[3][0] - points[0][0]; + float dy14 = points[3][1] - points[0][1]; + + return (floatsEqual(dx12 * dy13, dx13 * dy12) && + floatsEqual(dx12 * dy14, dx14 * dy12)); + } + + return VG_FALSE; +} + +static INLINE void compute_pt_normal(float *pt1, float *pt2, float *res) +{ + float line[4]; + float normal[4]; + line[0] = 0.f; line[1] = 0.f; + line[2] = pt2[0] - pt1[0]; + line[3] = pt2[1] - pt1[1]; + line_normal(line, normal); + line_normalize(normal); + + res[0] = normal[2]; + res[1] = normal[3]; +} + +static enum shift_result shift(const struct bezier *orig, + struct bezier *shifted, + float offset, float threshold) +{ + int map[4]; + VGboolean p1_p2_equal = (orig->x1 == orig->x2 && orig->y1 == orig->y2); + VGboolean p2_p3_equal = (orig->x2 == orig->x3 && orig->y2 == orig->y3); + VGboolean p3_p4_equal = (orig->x3 == orig->x4 && orig->y3 == orig->y4); + + float points[4][2]; + int np = 0; + float bounds[4]; + float points_shifted[4][2]; + float prev_normal[2]; + + points[np][0] = orig->x1; + points[np][1] = orig->y1; + map[0] = 0; + ++np; + if (!p1_p2_equal) { + points[np][0] = orig->x2; + points[np][1] = orig->y2; + ++np; + } + map[1] = np - 1; + if (!p2_p3_equal) { + points[np][0] = orig->x3; + points[np][1] = orig->y3; + ++np; + } + map[2] = np - 1; + if (!p3_p4_equal) { + points[np][0] = orig->x4; + points[np][1] = orig->y4; + ++np; + } + map[3] = np - 1; + if (np == 1) + return Discard; + + /* We need to specialcase lines of 3 or 4 points due to numerical + instability in intersection code below */ + if (np > 2 && is_bezier_line(points, np)) { + float l[4] = { points[0][0], points[0][1], + points[np-1][0], points[np-1][1] }; + float ctrl1[2], ctrl2[2]; + if (floatsEqual(points[0][0], points[np-1][0]) && + floatsEqual(points[0][1], points[np-1][1])) + return Discard; + + shift_line_by_normal(l, offset); + line_point_at(l, 0.33, ctrl1); + line_point_at(l, 0.66, ctrl2); + bezier_init(shifted, l[0], l[1], + ctrl1[0], ctrl1[1], ctrl2[0], ctrl2[1], + l[2], l[3]); + return Ok; + } + + bezier_bounds(orig, bounds); + if (np == 4 && bounds[2] < .1*offset && bounds[3] < .1*offset) { + float l = (orig->x1 - orig->x2)*(orig->x1 - orig->x2) + + (orig->y1 - orig->y2)*(orig->y1 - orig->y1) * + (orig->x3 - orig->x4)*(orig->x3 - orig->x4) + + (orig->y3 - orig->y4)*(orig->y3 - orig->y4); + float dot = (orig->x1 - orig->x2)*(orig->x3 - orig->x4) + + (orig->y1 - orig->y2)*(orig->y3 - orig->y4); + if (dot < 0 && dot*dot < 0.8*l) + /* the points are close and reverse dirction. Approximate the whole + thing by a semi circle */ + return Circle; + } + + compute_pt_normal(points[0], points[1], prev_normal); + + points_shifted[0][0] = points[0][0] + offset * prev_normal[0]; + points_shifted[0][1] = points[0][1] + offset * prev_normal[1]; + + for (int i = 1; i < np - 1; ++i) { + float normal_sum[2], r; + float next_normal[2]; + compute_pt_normal(points[i], points[i + 1], next_normal); + + normal_sum[0] = prev_normal[0] + next_normal[0]; + normal_sum[1] = prev_normal[1] + next_normal[1]; + + r = 1.0 + prev_normal[0] * next_normal[0] + + prev_normal[1] * next_normal[1]; + + if (floatsEqual(r + 1, 1)) { + points_shifted[i][0] = points[i][0] + offset * prev_normal[0]; + points_shifted[i][1] = points[i][1] + offset * prev_normal[1]; + } else { + float k = offset / r; + points_shifted[i][0] = points[i][0] + k * normal_sum[0]; + points_shifted[i][1] = points[i][1] + k * normal_sum[1]; + } + + prev_normal[0] = next_normal[0]; + prev_normal[1] = next_normal[1]; + } + + points_shifted[np - 1][0] = points[np - 1][0] + offset * prev_normal[0]; + points_shifted[np - 1][1] = points[np - 1][1] + offset * prev_normal[1]; + + bezier_init2v(shifted, + points_shifted[map[0]], points_shifted[map[1]], + points_shifted[map[2]], points_shifted[map[3]]); + + return good_offset(orig, shifted, offset, threshold); +} + +static VGboolean make_circle(const struct bezier *b, float offset, struct bezier *o) +{ + float normals[3][2]; + float dist; + float angles[2]; + float sign = 1.f; + int i; + float circle[3][2]; + + normals[0][0] = b->y2 - b->y1; + normals[0][1] = b->x1 - b->x2; + dist = sqrt(normals[0][0]*normals[0][0] + normals[0][1]*normals[0][1]); + if (floatsEqual(dist + 1, 1.f)) + return VG_FALSE; + normals[0][0] /= dist; + normals[0][1] /= dist; + + normals[2][0] = b->y4 - b->y3; + normals[2][1] = b->x3 - b->x4; + dist = sqrt(normals[2][0]*normals[2][0] + normals[2][1]*normals[2][1]); + if (floatsEqual(dist + 1, 1.f)) + return VG_FALSE; + normals[2][0] /= dist; + normals[2][1] /= dist; + + normals[1][0] = b->x1 - b->x2 - b->x3 + b->x4; + normals[1][1] = b->y1 - b->y2 - b->y3 + b->y4; + dist = -1*sqrt(normals[1][0]*normals[1][0] + normals[1][1]*normals[1][1]); + normals[1][0] /= dist; + normals[1][1] /= dist; + + for (i = 0; i < 2; ++i) { + float cos_a = normals[i][0]*normals[i+1][0] + normals[i][1]*normals[i+1][1]; + if (cos_a > 1.) + cos_a = 1.; + if (cos_a < -1.) + cos_a = -1; + angles[i] = acos(cos_a)/M_PI; + } + + if (angles[0] + angles[1] > 1.) { + /* more than 180 degrees */ + normals[1][0] = -normals[1][0]; + normals[1][1] = -normals[1][1]; + angles[0] = 1. - angles[0]; + angles[1] = 1. - angles[1]; + sign = -1.; + } + + circle[0][0] = b->x1 + normals[0][0]*offset; + circle[0][1] = b->y1 + normals[0][1]*offset; + + circle[1][0] = 0.5*(b->x1 + b->x4) + normals[1][0]*offset; + circle[1][1] = 0.5*(b->y1 + b->y4) + normals[1][1]*offset; + + circle[2][0] = b->x4 + normals[2][0]*offset; + circle[2][1] = b->y4 + normals[2][1]*offset; + + for (i = 0; i < 2; ++i) { + float kappa = 2.*KAPPA * sign * offset * angles[i]; + + o->x1 = circle[i][0]; + o->y1 = circle[i][1]; + o->x2 = circle[i][0] - normals[i][1]*kappa; + o->y2 = circle[i][1] + normals[i][0]*kappa; + o->x3 = circle[i+1][0] + normals[i+1][1]*kappa; + o->y3 = circle[i+1][1] - normals[i+1][0]*kappa; + o->x4 = circle[i+1][0]; + o->y4 = circle[i+1][1]; + + ++o; + } + return VG_TRUE; +} + +int bezier_translate_by_normal(struct bezier *bez, + struct bezier *curves, + int max_curves, + float normal_len, + float threshold) +{ + struct bezier beziers[10]; + struct bezier *b, *o; + + /* fixme: this should really be floatsEqual */ + if (bez->x1 == bez->x2 && bez->x1 == bez->x3 && bez->x1 == bez->x4 && + bez->y1 == bez->y2 && bez->y1 == bez->y3 && bez->y1 == bez->y4) + return 0; + + --max_curves; +redo: + beziers[0] = *bez; + b = beziers; + o = curves; + + while (b >= beziers) { + int stack_segments = b - beziers + 1; + enum shift_result res; + if ((stack_segments == 10) || (o - curves == max_curves - stack_segments)) { + threshold *= 1.5; + if (threshold > 2.) + goto give_up; + goto redo; + } + res = shift(b, o, normal_len, threshold); + if (res == Discard) { + --b; + } else if (res == Ok) { + ++o; + --b; + continue; + } else if (res == Circle && max_curves - (o - curves) >= 2) { + /* add semi circle */ + if (make_circle(b, normal_len, o)) + o += 2; + --b; + } else { + split(b, b+1, b); + ++b; + } + } + +give_up: + while (b >= beziers) { + enum shift_result res = shift(b, o, normal_len, threshold); + + /* if res isn't Ok or Split then *o is undefined */ + if (res == Ok || res == Split) + ++o; + + --b; + } + + debug_assert(o - curves <= max_curves); + return o - curves; +} + +void bezier_bounds(const struct bezier *bez, + float *bounds/*x/y/width/height*/) +{ + float xmin = bez->x1; + float xmax = bez->x1; + float ymin = bez->y1; + float ymax = bez->y1; + + if (bez->x2 < xmin) + xmin = bez->x2; + else if (bez->x2 > xmax) + xmax = bez->x2; + if (bez->x3 < xmin) + xmin = bez->x3; + else if (bez->x3 > xmax) + xmax = bez->x3; + if (bez->x4 < xmin) + xmin = bez->x4; + else if (bez->x4 > xmax) + xmax = bez->x4; + + if (bez->y2 < ymin) + ymin = bez->y2; + else if (bez->y2 > ymax) + ymax = bez->y2; + if (bez->y3 < ymin) + ymin = bez->y3; + else if (bez->y3 > ymax) + ymax = bez->y3; + if (bez->y4 < ymin) + ymin = bez->y4; + else if (bez->y4 > ymax) + ymax = bez->y4; + + bounds[0] = xmin; /* x */ + bounds[1] = ymin; /* y */ + bounds[2] = xmax - xmin; /* width */ + bounds[3] = ymax - ymin; /* height */ +} + +void bezier_start_tangent(const struct bezier *bez, + float *tangent) +{ + tangent[0] = bez->x1; + tangent[1] = bez->y1; + tangent[2] = bez->x2; + tangent[3] = bez->y2; + + if (null_line(tangent)) { + tangent[0] = bez->x1; + tangent[1] = bez->y1; + tangent[2] = bez->x3; + tangent[3] = bez->y3; + } + if (null_line(tangent)) { + tangent[0] = bez->x1; + tangent[1] = bez->y1; + tangent[2] = bez->x4; + tangent[3] = bez->y4; + } +} + + +static INLINE VGfloat bezier_t_at_length(struct bezier *bez, + VGfloat at_length, + VGfloat error) +{ + VGfloat len = bezier_length(bez, error); + VGfloat t = 1.0; + VGfloat last_bigger = 1.; + + if (at_length > len || floatsEqual(at_length, len)) + return t; + + if (floatIsZero(at_length)) + return 0.f; + + t *= 0.5; + while (1) { + struct bezier right = *bez; + struct bezier left; + VGfloat tmp_len; + split_left(&right, t, &left); + tmp_len = bezier_length(&left, error); + if (ABS(tmp_len - at_length) < error) + break; + + if (tmp_len < at_length) { + t += (last_bigger - t)*.5; + } else { + last_bigger = t; + t -= t*.5; + } + } + return t; +} + +void bezier_point_at_length(struct bezier *bez, + float length, + float *point, + float *normal) +{ + /* ~0.000001 seems to be required to pass G2080x tests */ + VGfloat t = bezier_t_at_length(bez, length, 0.000001); + bezier_point_at(bez, t, point); + bezier_normal_at(bez, t, normal); + vector_unit(normal); +} + +void bezier_point_at_t(struct bezier *bez, float t, + float *point, float *normal) +{ + bezier_point_at(bez, t, point); + bezier_normal_at(bez, t, normal); + vector_unit(normal); +} + +void bezier_exact_bounds(const struct bezier *bez, + float *bounds/*x/y/width/height*/) +{ + struct polygon *poly = polygon_create(64); + polygon_vertex_append(poly, bez->x1, bez->y1); + bezier_add_to_polygon(bez, poly); + polygon_bounding_rect(poly, bounds); + polygon_destroy(poly); +} + diff --git a/src/gallium/state_trackers/vega/bezier.h b/src/gallium/state_trackers/vega/bezier.h new file mode 100644 index 0000000000..e06666051c --- /dev/null +++ b/src/gallium/state_trackers/vega/bezier.h @@ -0,0 +1,81 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef BEZIER_H +#define BEZIER_H + +struct polygon; +struct matrix; + +struct bezier { + float x1, y1; + float x2, y2; + float x3, y3; + float x4, y4; +}; + + +#define BEZIER_DEFAULT_ERROR 0.01 + +/* kappa as being l of a circle with r = 1, we can emulate any + * circle of radius r by using the formula + * l = r . kappa + * More at: + * http://www.whizkidtech.redprince.net/bezier/circle/ */ +#define KAPPA 0.5522847498 + +void bezier_init(struct bezier *bez, + float x1, float y1, + float x2, float y2, + float x3, float y3, + float x4, float y4); + +struct polygon *bezier_to_polygon(struct bezier *bez); +void bezier_add_to_polygon(const struct bezier *bez, + struct polygon *poly); +float bezier_length(struct bezier *bez, float error); +void bezier_transform(struct bezier *bez, + struct matrix *mat); + +int bezier_translate_by_normal(struct bezier *b, + struct bezier *curves, + int max_curves, + float normal_len, + float threshold); +void bezier_bounds(const struct bezier *bez, + float *bounds/*x/y/width/height*/); +void bezier_exact_bounds(const struct bezier *bez, + float *bounds/*x/y/width/height*/); + +void bezier_start_tangent(const struct bezier *bez, + float *tangent); + +void bezier_point_at_length(struct bezier *bez, float length, + float *point, float *normal); +void bezier_point_at_t(struct bezier *bez, float t, + float *point, float *normal); + +#endif diff --git a/src/gallium/state_trackers/vega/image.c b/src/gallium/state_trackers/vega/image.c new file mode 100644 index 0000000000..9a722980d5 --- /dev/null +++ b/src/gallium/state_trackers/vega/image.c @@ -0,0 +1,654 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "image.h" + +#include "vg_translate.h" +#include "vg_context.h" +#include "matrix.h" +#include "renderer.h" +#include "util_array.h" +#include "api_consts.h" +#include "shaders_cache.h" +#include "shader.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_inlines.h" +#include "util/u_blit.h" +#include "util/u_tile.h" +#include "util/u_memory.h" +#include "util/u_math.h" + +static enum pipe_format vg_format_to_pipe(VGImageFormat format) +{ + switch(format) { + case VG_sRGB_565: + return PIPE_FORMAT_R5G6B5_UNORM; + case VG_sRGBA_5551: + return PIPE_FORMAT_A1R5G5B5_UNORM; + case VG_sRGBA_4444: + return PIPE_FORMAT_A4R4G4B4_UNORM; + case VG_sL_8: + case VG_lL_8: + return PIPE_FORMAT_L8_UNORM; + case VG_BW_1: + return PIPE_FORMAT_A8R8G8B8_UNORM; + case VG_A_8: + return PIPE_FORMAT_A8_UNORM; +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: + case VG_A_4: + return PIPE_FORMAT_A8_UNORM; +#endif + default: + return PIPE_FORMAT_A8R8G8B8_UNORM; + } +} + +static INLINE void vg_sync_size(VGfloat *src_loc, VGfloat *dst_loc) +{ + src_loc[2] = MIN2(src_loc[2], dst_loc[2]); + src_loc[3] = MIN2(src_loc[3], dst_loc[3]); + dst_loc[2] = src_loc[2]; + dst_loc[3] = src_loc[3]; +} + + +static void vg_copy_texture(struct vg_context *ctx, + struct pipe_texture *dst, VGint dx, VGint dy, + struct pipe_texture *src, VGint sx, VGint sy, + VGint width, VGint height) +{ + VGfloat dst_loc[4], src_loc[4]; + VGfloat dst_bounds[4], src_bounds[4]; + VGfloat src_shift[4], dst_shift[4], shift[4]; + + dst_loc[0] = dx; + dst_loc[1] = dy; + dst_loc[2] = width; + dst_loc[3] = height; + dst_bounds[0] = 0.f; + dst_bounds[1] = 0.f; + dst_bounds[2] = dst->width[0]; + dst_bounds[3] = dst->height[0]; + + src_loc[0] = sx; + src_loc[1] = sy; + src_loc[2] = width; + src_loc[3] = height; + src_bounds[0] = 0.f; + src_bounds[1] = 0.f; + src_bounds[2] = src->width[0]; + src_bounds[3] = src->height[0]; + + vg_bound_rect(src_loc, src_bounds, src_shift); + vg_bound_rect(dst_loc, dst_bounds, dst_shift); + shift[0] = src_shift[0] - dst_shift[0]; + shift[1] = src_shift[1] - dst_shift[1]; + + if (shift[0] < 0) + vg_shift_rectx(src_loc, src_bounds, -shift[0]); + else + vg_shift_rectx(dst_loc, dst_bounds, shift[0]); + + if (shift[1] < 0) + vg_shift_recty(src_loc, src_bounds, -shift[1]); + else + vg_shift_recty(dst_loc, dst_bounds, shift[1]); + + vg_sync_size(src_loc, dst_loc); + + if (src_loc[2] >= 0 && src_loc[3] >= 0 && + dst_loc[2] >= 0 && dst_loc[3] >= 0) { + renderer_copy_texture(ctx->renderer, + src, + src_loc[0], + src_loc[1] + src_loc[3], + src_loc[0] + src_loc[2], + src_loc[1], + dst, + dst_loc[0], + dst_loc[1] + dst_loc[3], + dst_loc[0] + dst_loc[2], + dst_loc[1]); + } + +} + +void vg_copy_surface(struct vg_context *ctx, + struct pipe_surface *dst, VGint dx, VGint dy, + struct pipe_surface *src, VGint sx, VGint sy, + VGint width, VGint height) +{ + VGfloat dst_loc[4], src_loc[4]; + VGfloat dst_bounds[4], src_bounds[4]; + VGfloat src_shift[4], dst_shift[4], shift[4]; + + dst_loc[0] = dx; + dst_loc[1] = dy; + dst_loc[2] = width; + dst_loc[3] = height; + dst_bounds[0] = 0.f; + dst_bounds[1] = 0.f; + dst_bounds[2] = dst->width; + dst_bounds[3] = dst->height; + + src_loc[0] = sx; + src_loc[1] = sy; + src_loc[2] = width; + src_loc[3] = height; + src_bounds[0] = 0.f; + src_bounds[1] = 0.f; + src_bounds[2] = src->width; + src_bounds[3] = src->height; + + vg_bound_rect(src_loc, src_bounds, src_shift); + vg_bound_rect(dst_loc, dst_bounds, dst_shift); + shift[0] = src_shift[0] - dst_shift[0]; + shift[1] = src_shift[1] - dst_shift[1]; + + if (shift[0] < 0) + vg_shift_rectx(src_loc, src_bounds, -shift[0]); + else + vg_shift_rectx(dst_loc, dst_bounds, shift[0]); + + if (shift[1] < 0) + vg_shift_recty(src_loc, src_bounds, -shift[1]); + else + vg_shift_recty(dst_loc, dst_bounds, shift[1]); + + vg_sync_size(src_loc, dst_loc); + + if (src_loc[2] > 0 && src_loc[3] > 0 && + dst_loc[2] > 0 && dst_loc[3] > 0) { + if (src == dst) + renderer_copy_surface(ctx->renderer, + src, + src_loc[0], + src->height - (src_loc[1] + src_loc[3]), + src_loc[0] + src_loc[2], + src->height - src_loc[1], + dst, + dst_loc[0], + dst->height - (dst_loc[1] + dst_loc[3]), + dst_loc[0] + dst_loc[2], + dst->height - dst_loc[1], + 0, 0); + else + renderer_copy_surface(ctx->renderer, + src, + src_loc[0], + src->height - src_loc[1], + src_loc[0] + src_loc[2], + src->height - (src_loc[1] + src_loc[3]), + dst, + dst_loc[0], + dst->height - (dst_loc[1] + dst_loc[3]), + dst_loc[0] + dst_loc[2], + dst->height - dst_loc[1], + 0, 0); + } + +} + +static struct pipe_texture *image_texture(struct vg_image *img) +{ + struct pipe_texture *tex = img->texture; + return tex; +} + + +static void image_cleari(struct vg_image *img, VGint clear_colori, + VGint x, VGint y, VGint width, VGint height) +{ + VGint *clearbuf; + VGint i; + VGfloat dwidth, dheight; + + clearbuf = malloc(sizeof(VGint)*width*height); + for (i = 0; i < width*height; ++i) + clearbuf[i] = clear_colori; + + dwidth = MIN2(width, img->width); + dheight = MIN2(height, img->height); + + image_sub_data(img, clearbuf, width * sizeof(VGint), + VG_sRGBA_8888, + x, y, dwidth, dheight); + free(clearbuf); +} + +struct vg_image * image_create(VGImageFormat format, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *image = CALLOC_STRUCT(vg_image); + enum pipe_format pformat = vg_format_to_pipe(format); + struct pipe_texture pt, *newtex; + struct pipe_screen *screen = ctx->pipe->screen; + + vg_init_object(&image->base, ctx, VG_OBJECT_IMAGE); + + image->format = format; + image->width = width; + image->height = height; + + image->sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.min_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + image->sampler.mag_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + image->sampler.normalized_coords = 1; + + assert(screen->is_format_supported(screen, pformat, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_SAMPLER, 0)); + + memset(&pt, 0, sizeof(pt)); + pt.target = PIPE_TEXTURE_2D; + pt.format = pformat; + pf_get_block(pformat, &pt.block); + pt.last_level = 0; + pt.width[0] = width; + pt.height[0] = height; + pt.depth[0] = 1; + pt.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER; + + newtex = screen->texture_create(screen, &pt); + + debug_assert(newtex); + + image->texture = newtex; + + vg_context_add_object(ctx, VG_OBJECT_IMAGE, image); + + image_cleari(image, 0, 0, 0, image->width, image->height); + return image; +} + +void image_destroy(struct vg_image *img) +{ + struct vg_context *ctx = vg_current_context(); + vg_context_remove_object(ctx, VG_OBJECT_IMAGE, img); + + + if (img->parent) { + /* remove img from the parent child array */ + int idx; + struct vg_image **array = + (struct vg_image **)img->parent->children_array->data; + + for (idx = 0; idx < img->parent->children_array->num_elements; ++idx) { + struct vg_image *child = array[idx]; + if (child == img) { + break; + } + } + debug_assert(idx < img->parent->children_array->num_elements); + array_remove_element(img->parent->children_array, idx); + } + + if (img->children_array && img->children_array->num_elements) { + /* reparent the children */ + VGint i; + struct vg_image *parent = img->parent; + struct vg_image **children = + (struct vg_image **)img->children_array->data; + if (!parent) { + VGint min_x = children[0]->x; + parent = children[0]; + + for (i = 1; i < img->children_array->num_elements; ++i) { + struct vg_image *child = children[i]; + if (child->x < min_x) { + parent = child; + } + } + } + + for (i = 0; i < img->children_array->num_elements; ++i) { + struct vg_image *child = children[i]; + if (child != parent) { + child->parent = parent; + if (!parent->children_array) { + parent->children_array = array_create( + sizeof(struct vg_image*)); + } + array_append_data(parent->children_array, + &child, 1); + } else + child->parent = NULL; + } + array_destroy(img->children_array); + } + + pipe_texture_reference(&img->texture, NULL); + free(img); +} + +void image_clear(struct vg_image *img, + VGint x, VGint y, VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat *clear_colorf = ctx->state.vg.clear_color; + VGubyte r, g, b ,a; + VGint clear_colori; + /* FIXME: this is very nasty */ + r = float_to_ubyte(clear_colorf[0]); + g = float_to_ubyte(clear_colorf[1]); + b = float_to_ubyte(clear_colorf[2]); + a = float_to_ubyte(clear_colorf[3]); + clear_colori = r << 24 | g << 16 | b << 8 | a; + image_cleari(img, clear_colori, x, y, width, height); +} + +void image_sub_data(struct vg_image *image, + const void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height) +{ + const VGint yStep = 1; + VGubyte *src = (VGubyte *)data; + VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4]; + VGfloat *df = (VGfloat*)temp; + VGint i; + struct vg_context *ctx = vg_current_context(); + struct pipe_screen *screen = ctx->pipe->screen; + struct pipe_texture *texture = image_texture(image); + VGint xoffset = 0, yoffset = 0; + + if (x < 0) { + xoffset -= x; + width += x; + x = 0; + } + if (y < 0) { + yoffset -= y; + height += y; + y = 0; + } + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (x > image->width || y > image->width) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + + if (x + width > image->width) { + width = image->width - x; + } + + if (y + height > image->height) { + height = image->height - y; + } + + { /* upload color_data */ + struct pipe_transfer *transfer = screen->get_tex_transfer( + screen, texture, 0, 0, 0, + PIPE_TRANSFER_WRITE, 0, 0, texture->width[0], texture->height[0]); + src += (dataStride * yoffset); + for (i = 0; i < height; i++) { + _vega_unpack_float_span_rgba(ctx, width, xoffset, src, dataFormat, temp); + pipe_put_tile_rgba(transfer, x+image->x, y+image->y, width, 1, df); + y += yStep; + src += dataStride; + } + screen->tex_transfer_destroy(transfer); + } +} + +void image_get_sub_data(struct vg_image * image, + void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4]; + VGfloat *df = (VGfloat*)temp; + VGint y = 0, yStep = 1; + VGint i; + VGubyte *dst = (VGubyte *)data; + + { + struct pipe_transfer *transfer = + screen->get_tex_transfer(screen, + image->texture, 0, 0, 0, + PIPE_TRANSFER_READ, + 0, 0, + image->x + image->width, + image->y + image->height); + /* Do a row at a time to flip image data vertically */ + for (i = 0; i < height; i++) { +#if 0 + debug_printf("%d-%d == %d\n", sy, height, y); +#endif + pipe_get_tile_rgba(transfer, sx+image->x, y, width, 1, df); + y += yStep; + _vega_pack_rgba_span_float(ctx, width, temp, dataFormat, dst); + dst += dataStride; + } + + screen->tex_transfer_destroy(transfer); + } +} + +struct vg_image * image_child_image(struct vg_image *parent, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_image *image = CALLOC_STRUCT(vg_image); + + vg_init_object(&image->base, ctx, VG_OBJECT_IMAGE); + + image->x = parent->x + x; + image->y = parent->y + y; + image->width = width; + image->height = height; + image->parent = parent; + image->texture = 0; + pipe_texture_reference(&image->texture, + parent->texture); + + image->sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + image->sampler.min_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + image->sampler.mag_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + image->sampler.normalized_coords = 1; + + if (!parent->children_array) + parent->children_array = array_create( + sizeof(struct vg_image*)); + + array_append_data(parent->children_array, + &image, 1); + + vg_context_add_object(ctx, VG_OBJECT_IMAGE, image); + + return image; +} + +void image_copy(struct vg_image *dst, VGint dx, VGint dy, + struct vg_image *src, VGint sx, VGint sy, + VGint width, VGint height, + VGboolean dither) +{ + struct vg_context *ctx = vg_current_context(); + + if (width <= 0 || height <= 0) { + vg_set_error(ctx, VG_ILLEGAL_ARGUMENT_ERROR); + return; + } + /* make sure rendering has completed */ + ctx->pipe->flush(ctx->pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + vg_copy_texture(ctx, dst->texture, dst->x + dx, dst->y + dy, + src->texture, src->x + sx, src->y + sy, width, height); +} + +void image_draw(struct vg_image *img) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat x1, y1; + VGfloat x2, y2; + VGfloat x3, y3; + VGfloat x4, y4; + struct matrix *matrix; + + x1 = 0; + y1 = 0; + x2 = img->width; + y2 = 0; + x3 = img->width; + y3 = img->height; + x4 = 0; + y4 = img->height; + + matrix = &ctx->state.vg.image_user_to_surface_matrix; + + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + matrix_map_point(matrix, x4, y4, &x4, &y4); + + shader_set_drawing_image(ctx->shader, VG_TRUE); + shader_set_paint(ctx->shader, ctx->state.vg.fill_paint); + shader_set_image(ctx->shader, img); + shader_bind(ctx->shader); + + renderer_texture_quad(ctx->renderer, image_texture(img), + img->x, img->y, img->x + img->width, img->y + img->height, + x1, y1, x2, y2, x3, y3, x4, y4); +} + +void image_set_pixels(VGint dx, VGint dy, + struct vg_image *src, VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_surface *surf; + struct st_renderbuffer *strb = ctx->draw_buffer->strb; + + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + + surf = screen->get_tex_surface(screen, image_texture(src), 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_READ); + + vg_copy_surface(ctx, strb->surface, dx, dy, + surf, sx+src->x, sy+src->y, width, height); + + screen->tex_surface_destroy(surf); +} + +void image_get_pixels(struct vg_image *dst, VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_surface *surf; + struct st_renderbuffer *strb = ctx->draw_buffer->strb; + + /* flip the y coordinates */ + /*dy = dst->height - dy - height;*/ + + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + + surf = screen->get_tex_surface(screen, image_texture(dst), 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE | + PIPE_BUFFER_USAGE_GPU_READ); + vg_copy_surface(ctx, surf, dst->x + dx, dst->y + dy, + strb->surface, sx, sy, width, height); + + pipe_surface_reference(&surf, NULL); +} + + +VGboolean vg_image_overlaps(struct vg_image *dst, + struct vg_image *src) +{ + if (dst == src || dst->parent == src || + dst == src->parent) + return VG_TRUE; + if (dst->parent && dst->parent == src->parent) { + VGfloat left1 = dst->x; + VGfloat left2 = src->x; + VGfloat right1 = dst->x + dst->width; + VGfloat right2 = src->x + src->width; + VGfloat bottom1 = dst->y; + VGfloat bottom2 = src->y; + VGfloat top1 = dst->y + dst->height; + VGfloat top2 = src->y + src->height; + + return !(left2 > right1 || right2 < left1 || + top2 > bottom1 || bottom2 < top1); + } + return VG_FALSE; +} + +VGint image_bind_samplers(struct vg_image *img, struct pipe_sampler_state **samplers, + struct pipe_texture **textures) +{ + img->sampler.min_img_filter = image_sampler_filter(img->base.ctx); + img->sampler.mag_img_filter = image_sampler_filter(img->base.ctx); + samplers[3] = &img->sampler; + textures[3] = img->texture; + return 1; +} + +VGint image_sampler_filter(struct vg_context *ctx) +{ + switch(ctx->state.vg.image_quality) { + case VG_IMAGE_QUALITY_NONANTIALIASED: + return PIPE_TEX_FILTER_NEAREST; + break; + case VG_IMAGE_QUALITY_FASTER: + return PIPE_TEX_FILTER_NEAREST; + break; + case VG_IMAGE_QUALITY_BETTER: + /*return PIPE_TEX_FILTER_ANISO;*/ + return PIPE_TEX_FILTER_LINEAR; + break; + default: + debug_printf("Unknown image quality"); + } + return PIPE_TEX_FILTER_NEAREST; +} diff --git a/src/gallium/state_trackers/vega/image.h b/src/gallium/state_trackers/vega/image.h new file mode 100644 index 0000000000..78e17cffa6 --- /dev/null +++ b/src/gallium/state_trackers/vega/image.h @@ -0,0 +1,104 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef IMAGES_H +#define IMAGES_H + +#include "vg_context.h" +#include "pipe/p_state.h" + +struct pipe_texture; +struct array; +struct vg_context; +struct pipe_surface; + +struct vg_image { + struct vg_object base; + VGImageFormat format; + VGint x, y; + VGint width, height; + + struct vg_image *parent; + + struct pipe_texture *texture; + struct pipe_sampler_state sampler; + + struct array *children_array; +}; + +struct vg_image *image_create(VGImageFormat format, + VGint width, VGint height); +void image_destroy(struct vg_image *img); + +void image_clear(struct vg_image *img, + VGint x, VGint y, VGint width, VGint height); + +void image_sub_data(struct vg_image *image, + const void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height); + +void image_get_sub_data(struct vg_image * image, + void * data, + VGint dataStride, + VGImageFormat dataFormat, + VGint x, VGint y, + VGint width, VGint height); + +struct vg_image *image_child_image(struct vg_image *parent, + VGint x, VGint y, + VGint width, VGint height); + +void image_copy(struct vg_image *dst, VGint dx, VGint dy, + struct vg_image *src, VGint sx, VGint sy, + VGint width, VGint height, + VGboolean dither); + +void image_draw(struct vg_image *img); + +void image_set_pixels(VGint dx, VGint dy, + struct vg_image *src, VGint sx, VGint sy, + VGint width, VGint height); +void image_get_pixels(struct vg_image *dst, VGint dx, VGint dy, + VGint sx, VGint sy, + VGint width, VGint height); + +VGint image_bind_samplers(struct vg_image *dst, struct pipe_sampler_state **samplers, + struct pipe_texture **textures); + +VGboolean vg_image_overlaps(struct vg_image *dst, + struct vg_image *src); + +VGint image_sampler_filter(struct vg_context *ctx); + +void vg_copy_surface(struct vg_context *ctx, + struct pipe_surface *dst, VGint dx, VGint dy, + struct pipe_surface *src, VGint sx, VGint sy, + VGint width, VGint height); + +#endif diff --git a/src/gallium/state_trackers/vega/mask.c b/src/gallium/state_trackers/vega/mask.c new file mode 100644 index 0000000000..24650a37d5 --- /dev/null +++ b/src/gallium/state_trackers/vega/mask.c @@ -0,0 +1,690 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "mask.h" + +#include "path.h" +#include "image.h" +#include "shaders_cache.h" +#include "renderer.h" +#include "asm_util.h" +#include "st_inlines.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_inlines.h" +#include "util/u_memory.h" + +struct vg_mask_layer { + struct vg_object base; + + VGint width; + VGint height; + + struct pipe_texture *texture; +}; + +static INLINE struct pipe_surface * +alpha_mask_surface(struct vg_context *ctx, int usage) +{ + struct pipe_screen *screen = ctx->pipe->screen; + struct st_framebuffer *stfb = ctx->draw_buffer; + return screen->get_tex_surface(screen, + stfb->alpha_mask, + 0, 0, 0, + usage); +} + +static INLINE VGboolean +intersect_rectangles(VGint dwidth, VGint dheight, + VGint swidth, VGint sheight, + VGint tx, VGint ty, + VGint twidth, VGint theight, + VGint *offsets, + VGint *location) +{ + if (tx + twidth <= 0 || tx >= dwidth) + return VG_FALSE; + if (ty + theight <= 0 || ty >= dheight) + return VG_FALSE; + + offsets[0] = 0; + offsets[1] = 0; + location[0] = tx; + location[1] = ty; + + if (tx < 0) { + offsets[0] -= tx; + location[0] = 0; + + location[2] = MIN2(tx + swidth, MIN2(dwidth, tx + twidth)); + offsets[2] = location[2]; + } else { + offsets[2] = MIN2(twidth, MIN2(dwidth - tx, swidth )); + location[2] = offsets[2]; + } + + if (ty < 0) { + offsets[1] -= ty; + location[1] = 0; + + location[3] = MIN2(ty + sheight, MIN2(dheight, ty + theight)); + offsets[3] = location[3]; + } else { + offsets[3] = MIN2(theight, MIN2(dheight - ty, sheight)); + location[3] = offsets[3]; + } + + return VG_TRUE; +} + +#if DEBUG_MASKS +static void read_alpha_mask(void * data, VGint dataStride, + VGImageFormat dataFormat, + VGint sx, VGint sy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + + struct st_framebuffer *stfb = ctx->draw_buffer; + struct st_renderbuffer *strb = stfb->alpha_mask; + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + + VGfloat temp[VEGA_MAX_IMAGE_WIDTH][4]; + VGfloat *df = (VGfloat*)temp; + VGint y = (fb->height - sy) - 1, yStep = -1; + VGint i; + VGubyte *dst = (VGubyte *)data; + VGint xoffset = 0, yoffset = 0; + + /* make sure rendering has completed */ + pipe->flush(pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + if (sx < 0) { + xoffset = -sx; + xoffset *= _vega_size_for_format(dataFormat); + width += sx; + sx = 0; + } + if (sy < 0) { + yoffset = -sy; + height += sy; + sy = 0; + y = (fb->height - sy) - 1; + yoffset *= dataStride; + } + + { + struct pipe_surface *surf; + + surf = screen->get_tex_surface(screen, strb->texture, 0, 0, 0, + PIPE_BUFFER_USAGE_CPU_READ); + + /* Do a row at a time to flip image data vertically */ + for (i = 0; i < height; i++) { +#if 0 + debug_printf("%d-%d == %d\n", sy, height, y); +#endif + pipe_get_tile_rgba(surf, sx, y, width, 1, df); + y += yStep; + _vega_pack_rgba_span_float(ctx, width, temp, dataFormat, + dst + yoffset + xoffset); + dst += dataStride; + } + + pipe_surface_reference(&surf, NULL); + } +} + +void save_alpha_to_file(const char *filename) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + VGint *data; + int i, j; + + data = malloc(sizeof(int) * fb->width * fb->height); + read_alpha_mask(data, fb->width * sizeof(int), + VG_sRGBA_8888, + 0, 0, fb->width, fb->height); + fprintf(stderr, "/*---------- start */\n"); + fprintf(stderr, "const int image_width = %d;\n", + fb->width); + fprintf(stderr, "const int image_height = %d;\n", + fb->height); + fprintf(stderr, "const int image_data = {\n"); + for (i = 0; i < fb->height; ++i) { + for (j = 0; j < fb->width; ++j) { + int rgba = data[i * fb->height + j]; + int argb = 0; + argb = (rgba >> 8); + argb |= ((rgba & 0xff) << 24); + fprintf(stderr, "0x%x, ", argb); + } + fprintf(stderr, "\n"); + } + fprintf(stderr, "};\n"); + fprintf(stderr, "/*---------- end */\n"); +} +#endif + +static void setup_mask_framebuffer(struct pipe_surface *surf, + VGint surf_width, VGint surf_height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_framebuffer_state fb; + + memset(&fb, 0, sizeof(fb)); + fb.width = surf_width; + fb.height = surf_height; + fb.nr_cbufs = 1; + fb.cbufs[0] = surf; + { + VGint i; + for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i) + fb.cbufs[i] = 0; + } + cso_set_framebuffer(ctx->cso_context, &fb); +} + + +/* setup shader constants */ +static void setup_mask_operation(VGMaskOperation operation) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_constant_buffer *cbuf = &ctx->mask.cbuf; + const VGint param_bytes = 4 * sizeof(VGfloat); + const VGfloat ones[4] = {1.f, 1.f, 1.f, 1.f}; + void *shader = 0; + + /* We always need to get a new buffer, to keep the drivers simple and + * avoid gratuitous rendering synchronization. + */ + pipe_buffer_reference(&cbuf->buffer, NULL); + + cbuf->buffer = pipe_buffer_create(ctx->pipe->screen, 1, + PIPE_BUFFER_USAGE_CONSTANT, + param_bytes); + if (cbuf->buffer) { + st_no_flush_pipe_buffer_write(ctx, cbuf->buffer, + 0, param_bytes, ones); + } + + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf); + switch (operation) { + case VG_UNION_MASK: { + if (!ctx->mask.union_fs) { + ctx->mask.union_fs = shader_create_from_text(ctx->pipe, + union_mask_asm, + 200, + PIPE_SHADER_FRAGMENT); + } + shader = ctx->mask.union_fs->driver; + } + break; + case VG_INTERSECT_MASK: { + if (!ctx->mask.intersect_fs) { + ctx->mask.intersect_fs = shader_create_from_text(ctx->pipe, + intersect_mask_asm, + 200, + PIPE_SHADER_FRAGMENT); + } + shader = ctx->mask.intersect_fs->driver; + } + break; + case VG_SUBTRACT_MASK: { + if (!ctx->mask.subtract_fs) { + ctx->mask.subtract_fs = shader_create_from_text(ctx->pipe, + subtract_mask_asm, + 200, + PIPE_SHADER_FRAGMENT); + } + shader = ctx->mask.subtract_fs->driver; + } + break; + case VG_SET_MASK: { + if (!ctx->mask.set_fs) { + ctx->mask.set_fs = shader_create_from_text(ctx->pipe, + set_mask_asm, + 200, + PIPE_SHADER_FRAGMENT); + } + shader = ctx->mask.set_fs->driver; + } + break; + default: + assert(0); + break; + } + cso_set_fragment_shader_handle(ctx->cso_context, shader); +} + +static void setup_mask_samplers(struct pipe_texture *umask) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_sampler_state *samplers[PIPE_MAX_SAMPLERS]; + struct pipe_texture *textures[PIPE_MAX_SAMPLERS]; + struct st_framebuffer *fb_buffers = ctx->draw_buffer; + struct pipe_texture *uprev = NULL; + struct pipe_sampler_state sampler; + + uprev = fb_buffers->blend_texture; + sampler = ctx->mask.sampler; + sampler.normalized_coords = 1; + + samplers[0] = NULL; + samplers[1] = NULL; + samplers[2] = NULL; + textures[0] = NULL; + textures[1] = NULL; + textures[2] = NULL; + + samplers[0] = &sampler; + samplers[1] = &ctx->mask.sampler; + + textures[0] = umask; + textures[1] = uprev; + + cso_set_samplers(ctx->cso_context, 2, + (const struct pipe_sampler_state **)samplers); + cso_set_sampler_textures(ctx->cso_context, 2, textures); +} + + +/* setup shader constants */ +static void setup_mask_fill(const VGfloat color[4]) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_constant_buffer *cbuf = &ctx->mask.cbuf; + const VGint param_bytes = 4 * sizeof(VGfloat); + + /* We always need to get a new buffer, to keep the drivers simple and + * avoid gratuitous rendering synchronization. + */ + pipe_buffer_reference(&cbuf->buffer, NULL); + + cbuf->buffer = pipe_buffer_create(ctx->pipe->screen, 1, + PIPE_BUFFER_USAGE_CONSTANT, + param_bytes); + if (cbuf->buffer) { + st_no_flush_pipe_buffer_write(ctx, cbuf->buffer, 0, param_bytes, color); + } + + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf); + cso_set_fragment_shader_handle(ctx->cso_context, + shaders_cache_fill(ctx->sc, + VEGA_SOLID_FILL_SHADER)); +} + +static void setup_mask_viewport() +{ + struct vg_context *ctx = vg_current_context(); + vg_set_viewport(ctx, VEGA_Y0_TOP); +} + +static void setup_mask_blend() +{ + struct vg_context *ctx = vg_current_context(); + + struct pipe_blend_state blend; + + memset(&blend, 0, sizeof(struct pipe_blend_state)); + blend.blend_enable = 1; + blend.colormask |= PIPE_MASK_R; + blend.colormask |= PIPE_MASK_G; + blend.colormask |= PIPE_MASK_B; + blend.colormask |= PIPE_MASK_A; + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + + cso_set_blend(ctx->cso_context, &blend); +} + + +static void surface_fill(struct pipe_surface *surf, + int surf_width, int surf_height, + int x, int y, int width, int height, + const VGfloat color[4]) +{ + struct vg_context *ctx = vg_current_context(); + + if (x < 0) { + width += x; + x = 0; + } + if (y < 0) { + height += y; + y = 0; + } + + cso_save_framebuffer(ctx->cso_context); + cso_save_blend(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + cso_save_viewport(ctx->cso_context); + + setup_mask_blend(); + setup_mask_fill(color); + setup_mask_framebuffer(surf, surf_width, surf_height); + setup_mask_viewport(); + + renderer_draw_quad(ctx->renderer, x, y, + x + width, y + height, 0.0f/*depth should be disabled*/); + + + /* make sure rendering has completed */ + ctx->pipe->flush(ctx->pipe, + PIPE_FLUSH_RENDER_CACHE | PIPE_FLUSH_FRAME, + NULL); + +#if DEBUG_MASKS + save_alpha_to_file(0); +#endif + + cso_restore_blend(ctx->cso_context); + cso_restore_framebuffer(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + cso_restore_viewport(ctx->cso_context); +} + + +static void mask_using_texture(struct pipe_texture *texture, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct pipe_surface *surface = + alpha_mask_surface(ctx, PIPE_BUFFER_USAGE_GPU_WRITE); + VGint offsets[4], loc[4]; + + if (!surface) + return; + if (!intersect_rectangles(surface->width, surface->height, + texture->width[0], texture->height[0], + x, y, width, height, + offsets, loc)) + return; +#if 0 + debug_printf("Offset = [%d, %d, %d, %d]\n", offsets[0], + offsets[1], offsets[2], offsets[3]); + debug_printf("Locati = [%d, %d, %d, %d]\n", loc[0], + loc[1], loc[2], loc[3]); +#endif + + /* prepare our blend surface */ + vg_prepare_blend_surface_from_mask(ctx); + + cso_save_samplers(ctx->cso_context); + cso_save_sampler_textures(ctx->cso_context); + cso_save_framebuffer(ctx->cso_context); + cso_save_blend(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + cso_save_viewport(ctx->cso_context); + + setup_mask_samplers(texture); + setup_mask_blend(); + setup_mask_operation(operation); + setup_mask_framebuffer(surface, surface->width, surface->height); + setup_mask_viewport(); + + /* render the quad to propagate the rendering from stencil */ + renderer_draw_texture(ctx->renderer, texture, + offsets[0], offsets[1], + offsets[0] + offsets[2], offsets[1] + offsets[3], + loc[0], loc[1], loc[0] + loc[2], loc[1] + loc[3]); + + /* make sure rendering has completed */ + ctx->pipe->flush(ctx->pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + cso_restore_blend(ctx->cso_context); + cso_restore_framebuffer(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + cso_restore_samplers(ctx->cso_context); + cso_restore_sampler_textures(ctx->cso_context); + cso_restore_viewport(ctx->cso_context); + + pipe_surface_reference(&surface, NULL); +} + + +#ifdef OPENVG_VERSION_1_1 + +struct vg_mask_layer * mask_layer_create(VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct vg_mask_layer *mask = 0; + + mask = CALLOC_STRUCT(vg_mask_layer); + vg_init_object(&mask->base, ctx, VG_OBJECT_MASK); + mask->width = width; + mask->height = height; + + { + struct pipe_texture pt; + struct pipe_screen *screen = ctx->pipe->screen; + + memset(&pt, 0, sizeof(pt)); + pt.target = PIPE_TEXTURE_2D; + pt.format = PIPE_FORMAT_A8R8G8B8_UNORM; + pf_get_block(PIPE_FORMAT_A8R8G8B8_UNORM, &pt.block); + pt.last_level = 0; + pt.width[0] = width; + pt.height[0] = height; + pt.depth[0] = 1; + pt.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER; + pt.compressed = 0; + + mask->texture = screen->texture_create(screen, &pt); + } + + vg_context_add_object(ctx, VG_OBJECT_MASK, mask); + + return mask; +} + +void mask_layer_destroy(struct vg_mask_layer *layer) +{ + struct vg_context *ctx = vg_current_context(); + + vg_context_remove_object(ctx, VG_OBJECT_MASK, layer); + pipe_texture_release(&layer->texture); + free(layer); +} + +void mask_layer_fill(struct vg_mask_layer *layer, + VGint x, VGint y, + VGint width, VGint height, + VGfloat value) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat alpha_color[4] = {0, 0, 0, 0}; + struct pipe_surface *surface; + + alpha_color[3] = value; + + surface = ctx->pipe->screen->get_tex_surface( + ctx->pipe->screen, layer->texture, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + surface_fill(surface, + layer->width, layer->height, + x, y, width, height, alpha_color); + + ctx->pipe->screen->tex_surface_release(ctx->pipe->screen, &surface); +} + +void mask_copy(struct vg_mask_layer *layer, + VGint sx, VGint sy, + VGint dx, VGint dy, + VGint width, VGint height) +{ + struct vg_context *ctx = vg_current_context(); + struct st_framebuffer *fb_buffers = ctx->draw_buffer; + + renderer_copy_texture(ctx->renderer, + layer->texture, + sx, sy, + sx + width, sy + height, + fb_buffers->alpha_mask, + dx, dy, + dx + width, dy + height); +} + +static void mask_layer_render_to(struct vg_mask_layer *layer, + struct path *path, + VGbitfield paint_modes) +{ + struct vg_context *ctx = vg_current_context(); + const VGfloat fill_color[4] = {1.f, 1.f, 1.f, 1.f}; + struct pipe_screen *screen = ctx->pipe->screen; + struct pipe_surface *surface; + + surface = screen->get_tex_surface(screen, layer->texture, 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + cso_save_framebuffer(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + cso_save_viewport(ctx->cso_context); + + setup_mask_blend(); + setup_mask_fill(fill_color); + setup_mask_framebuffer(surface, layer->width, layer->height); + setup_mask_viewport(); + + if (paint_modes & VG_FILL_PATH) { + struct matrix *mat = &ctx->state.vg.path_user_to_surface_matrix; + path_fill(path, mat); + } + + if (paint_modes & VG_STROKE_PATH){ + path_stroke(path); + } + + + /* make sure rendering has completed */ + ctx->pipe->flush(ctx->pipe, PIPE_FLUSH_RENDER_CACHE, NULL); + + cso_restore_framebuffer(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + cso_restore_viewport(ctx->cso_context); + ctx->state.dirty |= BLEND_DIRTY; + + screen->tex_surface_release(ctx->pipe->screen, &surface); +} + +void mask_render_to(struct path *path, + VGbitfield paint_modes, + VGMaskOperation operation) +{ + struct vg_context *ctx = vg_current_context(); + struct st_framebuffer *fb_buffers = ctx->draw_buffer; + struct vg_mask_layer *temp_layer; + VGint width, height; + + width = fb_buffers->alpha_mask->width[0]; + height = fb_buffers->alpha_mask->width[0]; + + temp_layer = mask_layer_create(width, height); + + mask_layer_render_to(temp_layer, path, paint_modes); + + mask_using_layer(temp_layer, 0, 0, width, height, + operation); + + mask_layer_destroy(temp_layer); +} + +void mask_using_layer(struct vg_mask_layer *layer, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height) +{ + mask_using_texture(layer->texture, operation, + x, y, width, height); +} + +VGint mask_layer_width(struct vg_mask_layer *layer) +{ + return layer->width; +} + +VGint mask_layer_height(struct vg_mask_layer *layer) +{ + return layer->height; +} + + +#endif + +void mask_using_image(struct vg_image *image, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height) +{ + mask_using_texture(image->texture, operation, + x, y, width, height); +} + +void mask_fill(VGint x, VGint y, VGint width, VGint height, + VGfloat value) +{ + struct vg_context *ctx = vg_current_context(); + VGfloat alpha_color[4] = {.0f, .0f, .0f, value}; + struct pipe_surface *surf = alpha_mask_surface( + ctx, PIPE_BUFFER_USAGE_GPU_WRITE); + +#if DEBUG_MASKS + debug_printf("mask_fill(%d, %d, %d, %d) with rgba(%f, %f, %f, %f)\n", + x, y, width, height, + alpha_color[0], alpha_color[1], + alpha_color[2], alpha_color[3]); + debug_printf("XXX %f === %f \n", + alpha_color[3], value); +#endif + + surface_fill(surf, surf->width, surf->height, + x, y, width, height, alpha_color); + + pipe_surface_reference(&surf, NULL); +} + +VGint mask_bind_samplers(struct pipe_sampler_state **samplers, + struct pipe_texture **textures) +{ + struct vg_context *ctx = vg_current_context(); + + if (ctx->state.vg.masking) { + struct st_framebuffer *fb_buffers = ctx->draw_buffer; + + samplers[1] = &ctx->mask.sampler; + textures[1] = fb_buffers->alpha_mask; + return 1; + } else + return 0; +} diff --git a/src/gallium/state_trackers/vega/mask.h b/src/gallium/state_trackers/vega/mask.h new file mode 100644 index 0000000000..5eaaede0e3 --- /dev/null +++ b/src/gallium/state_trackers/vega/mask.h @@ -0,0 +1,68 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef MASK_H +#define MASK_H + +#include "vg_context.h" + +struct path; +struct vg_image; +struct pipe_texture; + +struct vg_mask_layer *mask_layer_create(VGint width, VGint height); +void mask_layer_destroy(struct vg_mask_layer *layer); +void mask_layer_fill(struct vg_mask_layer *layer, + VGint x, VGint y, + VGint width, VGint height, + VGfloat value); +VGint mask_layer_width(struct vg_mask_layer *layer); +VGint mask_layer_height(struct vg_mask_layer *layer); +void mask_copy(struct vg_mask_layer *layer, + VGint sx, VGint sy, + VGint dx, VGint dy, + VGint width, VGint height); + +void mask_render_to(struct path *path, + VGbitfield paint_modes, + VGMaskOperation operation); + +void mask_using_layer(struct vg_mask_layer *layer, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height); +void mask_using_image(struct vg_image *image, + VGMaskOperation operation, + VGint x, VGint y, + VGint width, VGint height); +void mask_fill(VGint x, VGint y, + VGint width, VGint height, + VGfloat value); + +VGint mask_bind_samplers(struct pipe_sampler_state **samplers, + struct pipe_texture **textures); + +#endif diff --git a/src/gallium/state_trackers/vega/matrix.h b/src/gallium/state_trackers/vega/matrix.h new file mode 100644 index 0000000000..4c207f912a --- /dev/null +++ b/src/gallium/state_trackers/vega/matrix.h @@ -0,0 +1,462 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef MATRIX_H +#define MATRIX_H + +#include "VG/openvg.h" + +#include "pipe/p_compiler.h" +#include "util/u_math.h" + +#include <stdio.h> +#include <math.h> + +#define floatsEqual(x, y) (fabs(x - y) <= 0.00001f * MIN2(fabs(x), fabs(y))) +#define floatIsZero(x) (floatsEqual((x) + 1, 1)) +#define ABS(x) (fabsf(x)) + +#define DEGREES_TO_RADIANS(d) (0.0174532925199 * (d)) +#define FLT_TO_INT(flt) float_to_int_floor(((VGuint*)&(flt))[0]) + +static INLINE VGint float_to_int_floor(VGuint bits) +{ + int sign = (bits >> 31) ? -1 : 1; + int exp = ((bits >> 23) & 255) - 127; + int mant = bits & 0x007fffff; + int sh = 23 - exp; + + /* abs(value) >= 2^31 -> clamp. */ + + if (exp >= 31) + return (VGint)((sign < 0) ? 0x80000000u : 0x7fffffffu); + + /* abs(value) < 1 -> return -1 or 0. */ + + if (exp < 0) + return (sign < 0 && (exp > -127 || mant != 0)) ? -1 : 0; + + /* abs(value) >= 2^23 -> shift left. */ + + mant |= 0x00800000; + if (sh <= 0) + return sign * (mant << -sh); + + /* Negative -> add a rounding term. */ + + if (sign < 0) + mant += (1 << sh) - 1; + + /* Shift right to obtain the result. */ + + return sign * (mant >> sh); +} + + +struct matrix { + VGfloat m[9]; +}; + +static INLINE void matrix_init(struct matrix *mat, + const VGfloat *val) +{ + memcpy(mat->m, val, sizeof(VGfloat) * 9); +} + +static INLINE void matrix_inits(struct matrix *mat, + VGfloat m11, VGfloat m12, VGfloat m13, + VGfloat m21, VGfloat m22, VGfloat m23, + VGfloat m31, VGfloat m32, VGfloat m33) +{ + mat->m[0] = m11; mat->m[1] = m12; mat->m[2] = m13; + mat->m[3] = m21; mat->m[4] = m22; mat->m[5] = m23; + mat->m[6] = m31; mat->m[7] = m32; mat->m[8] = m33; +} + +static INLINE void matrix_load_identity(struct matrix *matrix) +{ + static const VGfloat identity[9] = {1.f, 0.f, 0.f, + 0.f, 1.f, 0.f, + 0.f, 0.f, 1.f}; + memcpy(matrix->m, identity, sizeof(identity)); +} + +static INLINE VGboolean matrix_is_identity(struct matrix *matrix) +{ + return floatsEqual(matrix->m[0], 1) && floatIsZero(matrix->m[1]) && + floatIsZero(matrix->m[2]) && + floatIsZero(matrix->m[3]) && floatsEqual(matrix->m[4], 1) && + floatIsZero(matrix->m[5]) && + floatIsZero(matrix->m[6]) && floatIsZero(matrix->m[7]) && + floatIsZero(matrix->m[8]); +} + +static INLINE VGboolean matrix_is_affine(struct matrix *matrix) +{ + return floatIsZero(matrix->m[2]) && floatIsZero(matrix->m[5]) + && floatsEqual(matrix->m[8], 1); +} + + +static INLINE void matrix_make_affine(struct matrix *matrix) +{ + matrix->m[2] = 0.f; + matrix->m[5] = 0.f; + matrix->m[8] = 1.f; +} + +static INLINE void matrix_mult(struct matrix *dst, + struct matrix *src) +{ + VGfloat m11 = dst->m[0]*src->m[0] + dst->m[3]*src->m[1] + dst->m[6]*src->m[2]; + VGfloat m12 = dst->m[0]*src->m[3] + dst->m[3]*src->m[4] + dst->m[6]*src->m[5]; + VGfloat m13 = dst->m[0]*src->m[6] + dst->m[3]*src->m[7] + dst->m[6]*src->m[8]; + + VGfloat m21 = dst->m[1]*src->m[0] + dst->m[4]*src->m[1] + dst->m[7]*src->m[2]; + VGfloat m22 = dst->m[1]*src->m[3] + dst->m[4]*src->m[4] + dst->m[7]*src->m[5]; + VGfloat m23 = dst->m[1]*src->m[6] + dst->m[4]*src->m[7] + dst->m[7]*src->m[8]; + + VGfloat m31 = dst->m[2]*src->m[0] + dst->m[5]*src->m[1] + dst->m[8]*src->m[2]; + VGfloat m32 = dst->m[2]*src->m[3] + dst->m[5]*src->m[4] + dst->m[8]*src->m[5]; + VGfloat m33 = dst->m[2]*src->m[6] + dst->m[5]*src->m[7] + dst->m[8]*src->m[8]; + + dst->m[0] = m11; dst->m[1] = m21; dst->m[2] = m31; + dst->m[3] = m12; dst->m[4] = m22; dst->m[5] = m32; + dst->m[6] = m13; dst->m[7] = m23; dst->m[8] = m33; +} + + +static INLINE void matrix_map_point(struct matrix *mat, + VGfloat x, VGfloat y, + VGfloat *out_x, VGfloat *out_y) +{ + /* to be able to do matrix_map_point(m, x, y, &x, &y) use + * temporaries */ + VGfloat tmp_x = x, tmp_y = y; + + *out_x = mat->m[0]*tmp_x + mat->m[3]*tmp_y + mat->m[6]; + *out_y = mat->m[1]*tmp_x + mat->m[4]*tmp_y + mat->m[7]; + if (!matrix_is_affine(mat)) { + VGfloat w = 1/(mat->m[2]*tmp_x + mat->m[5]*tmp_y + mat->m[8]); + *out_x *= w; + *out_y *= w; + } +} + +static INLINE void matrix_translate(struct matrix *dst, + VGfloat tx, VGfloat ty) +{ + if (!matrix_is_affine(dst)) { + struct matrix trans_matrix; + matrix_load_identity(&trans_matrix); + trans_matrix.m[6] = tx; + trans_matrix.m[7] = ty; + matrix_mult(dst, &trans_matrix); + } else { + dst->m[6] += tx*dst->m[0] + ty*dst->m[3]; + dst->m[7] += ty*dst->m[4] + tx*dst->m[1]; + } +} + +static INLINE void matrix_scale(struct matrix *dst, + VGfloat sx, VGfloat sy) +{ + if (!matrix_is_affine(dst)) { + struct matrix scale_matrix; + matrix_load_identity(&scale_matrix); + scale_matrix.m[0] = sx; + scale_matrix.m[4] = sy; + matrix_mult(dst, &scale_matrix); + } else { + dst->m[0] *= sx; dst->m[1] *= sx; + dst->m[3] *= sy; dst->m[4] *= sy; + } +} + +static INLINE void matrix_shear(struct matrix *dst, + VGfloat shx, VGfloat shy) +{ + struct matrix shear_matrix; + matrix_load_identity(&shear_matrix); + shear_matrix.m[1] = shy; + shear_matrix.m[3] = shx; + matrix_mult(dst, &shear_matrix); +} + +static INLINE void matrix_rotate(struct matrix *dst, + VGfloat angle) +{ + struct matrix mat; + float sin_val = 0; + float cos_val = 0; + + + if (floatsEqual(angle, 90) || floatsEqual(angle, -270)) + sin_val = 1.f; + else if (floatsEqual(angle, 270) || floatsEqual(angle, -90)) + sin_val = -1.f; + else if (floatsEqual(angle, 180)) + cos_val = -1.f; + else { + float radians = DEGREES_TO_RADIANS(angle); + sin_val = sin(radians); + cos_val = cos(radians); + } + + if (!matrix_is_affine(dst)) { + matrix_load_identity(&mat); + mat.m[0] = cos_val; mat.m[1] = sin_val; + mat.m[3] = -sin_val; mat.m[4] = cos_val; + + matrix_mult(dst, &mat); + } else { + VGfloat m11 = cos_val*dst->m[0] + sin_val*dst->m[3]; + VGfloat m12 = cos_val*dst->m[1] + sin_val*dst->m[4]; + VGfloat m21 = -sin_val*dst->m[0] + cos_val*dst->m[3]; + VGfloat m22 = -sin_val*dst->m[1] + cos_val*dst->m[4]; + dst->m[0] = m11; dst->m[1] = m12; + dst->m[3] = m21; dst->m[4] = m22; + } +} + + +static INLINE VGfloat matrix_determinant(struct matrix *mat) +{ + return mat->m[0]*(mat->m[8]*mat->m[4]-mat->m[7]*mat->m[5]) - + mat->m[3]*(mat->m[8]*mat->m[1]-mat->m[7]*mat->m[2])+ + mat->m[6]*(mat->m[5]*mat->m[1]-mat->m[4]*mat->m[2]); +} + + +static INLINE void matrix_adjoint(struct matrix *mat) +{ + VGfloat h[9]; + h[0] = mat->m[4]*mat->m[8] - mat->m[5]*mat->m[7]; + h[3] = mat->m[5]*mat->m[6] - mat->m[3]*mat->m[8]; + h[6] = mat->m[3]*mat->m[7] - mat->m[4]*mat->m[6]; + h[1] = mat->m[2]*mat->m[7] - mat->m[1]*mat->m[8]; + h[4] = mat->m[0]*mat->m[8] - mat->m[2]*mat->m[6]; + h[7] = mat->m[1]*mat->m[6] - mat->m[0]*mat->m[7]; + h[2] = mat->m[1]*mat->m[5] - mat->m[2]*mat->m[4]; + h[5] = mat->m[2]*mat->m[3] - mat->m[0]*mat->m[5]; + h[8] = mat->m[0]*mat->m[4] - mat->m[1]*mat->m[3]; + + + memcpy(mat->m, h, sizeof(VGfloat) * 9); +} + +static INLINE void matrix_divs(struct matrix *mat, + VGfloat s) +{ + mat->m[0] /= s; + mat->m[1] /= s; + mat->m[2] /= s; + mat->m[3] /= s; + mat->m[4] /= s; + mat->m[5] /= s; + mat->m[6] /= s; + mat->m[7] /= s; + mat->m[8] /= s; +} + +static INLINE VGboolean matrix_invert(struct matrix *mat) +{ + VGfloat det = matrix_determinant(mat); + + if (floatIsZero(det)) + return VG_FALSE; + + matrix_adjoint(mat); + matrix_divs(mat, det); + return VG_TRUE; +} + +static INLINE VGboolean matrix_is_invertible(struct matrix *mat) +{ + return !floatIsZero(matrix_determinant(mat)); +} + + +static INLINE VGboolean matrix_square_to_quad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx3, VGfloat dy3, + VGfloat dx2, VGfloat dy2, + struct matrix *mat) +{ + VGfloat ax = dx0 - dx1 + dx2 - dx3; + VGfloat ay = dy0 - dy1 + dy2 - dy3; + + if (floatIsZero(ax) && floatIsZero(ay)) { + /* affine case */ + matrix_inits(mat, + dx1 - dx0, dy1 - dy0, 0, + dx2 - dx1, dy2 - dy1, 0, + dx0, dy0, 1); + } else { + VGfloat a, b, c, d, e, f, g, h; + VGfloat ax1 = dx1 - dx2; + VGfloat ax2 = dx3 - dx2; + VGfloat ay1 = dy1 - dy2; + VGfloat ay2 = dy3 - dy2; + + /* determinants */ + VGfloat gtop = ax * ay2 - ax2 * ay; + VGfloat htop = ax1 * ay - ax * ay1; + VGfloat bottom = ax1 * ay2 - ax2 * ay1; + + if (!bottom) + return VG_FALSE; + + g = gtop / bottom; + h = htop / bottom; + + a = dx1 - dx0 + g * dx1; + b = dx3 - dx0 + h * dx3; + c = dx0; + d = dy1 - dy0 + g * dy1; + e = dy3 - dy0 + h * dy3; + f = dy0; + + matrix_inits(mat, + a, d, g, + b, e, h, + c, f, 1.f); + } + + return VG_TRUE; +} + +static INLINE VGboolean matrix_quad_to_square(VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + struct matrix *mat) +{ + if (!matrix_square_to_quad(sx0, sy0, sx1, sy1, + sx2, sy2, sx3, sy3, + mat)) + return VG_FALSE; + + return matrix_invert(mat); +} + + +static INLINE VGboolean matrix_quad_to_quad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2, + VGfloat dx3, VGfloat dy3, + VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + struct matrix *mat) +{ + struct matrix sqr_to_qd; + + if (!matrix_square_to_quad(dx0, dy0, dx1, dy1, + dx2, dy2, dx3, dy3, + mat)) + return VG_FALSE; + + if (!matrix_quad_to_square(sx0, sy0, sx1, sy1, + sx2, sy2, sx3, sy3, + &sqr_to_qd)) + return VG_FALSE; + + matrix_mult(mat, &sqr_to_qd); + + return VG_TRUE; +} + + +static INLINE VGboolean null_line(const VGfloat *l) +{ + return floatsEqual(l[0], l[2]) && floatsEqual(l[1], l[3]); +} + +static INLINE void line_normal(float *l, float *norm) +{ + norm[0] = l[0]; + norm[1] = l[1]; + + norm[2] = l[0] + (l[3] - l[1]); + norm[3] = l[1] - (l[2] - l[0]); +} + +static INLINE void line_normalize(float *l) +{ + float x = l[2] - l[0]; + float y = l[3] - l[1]; + float len = sqrt(x*x + y*y); + l[2] = l[0] + x/len; + l[3] = l[1] + y/len; +} + +static INLINE VGfloat line_length(VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2) +{ + VGfloat x = x2 - x1; + VGfloat y = y2 - y1; + return sqrt(x*x + y*y); +} + +static INLINE VGfloat line_lengthv(const VGfloat *l) +{ + VGfloat x = l[2] - l[0]; + VGfloat y = l[3] - l[1]; + return sqrt(x*x + y*y); +} + + +static INLINE void line_point_at(float *l, float t, float *pt) +{ + float dx = l[2] - l[0]; + float dy = l[3] - l[1]; + + pt[0] = l[0] + dx * t; + pt[1] = l[1] + dy * t; +} + +static INLINE void vector_unit(float *vec) +{ + float len = sqrt(vec[0] * vec[0] + vec[1] * vec[1]); + vec[0] /= len; + vec[1] /= len; +} + +static INLINE void line_normal_vector(float *line, float *vec) +{ + VGfloat normal[4]; + + line_normal(line, normal); + + vec[0] = normal[2] - normal[0]; + vec[1] = normal[3] - normal[1]; + + vector_unit(vec); +} + +#endif diff --git a/src/gallium/state_trackers/vega/paint.c b/src/gallium/state_trackers/vega/paint.c new file mode 100644 index 0000000000..04a6ba9cdc --- /dev/null +++ b/src/gallium/state_trackers/vega/paint.c @@ -0,0 +1,699 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "paint.h" + +#include "shaders_cache.h" +#include "matrix.h" +#include "image.h" +#include "st_inlines.h" + +#include "pipe/p_compiler.h" +#include "pipe/p_inlines.h" + +#include "util/u_memory.h" +#include "util/u_math.h" + +#include "cso_cache/cso_context.h" + +struct vg_paint { + struct vg_object base; + + VGPaintType type; + + struct { + VGfloat color[4]; + VGint colori[4]; + } solid; + + struct { + VGColorRampSpreadMode spread; + VGuint color_data[1024]; + struct { + VGfloat coords[4]; + VGint coordsi[4]; + } linear; + struct { + VGfloat vals[5]; + VGint valsi[5]; + } radial; + struct pipe_texture *texture; + struct pipe_sampler_state sampler; + + VGfloat *ramp_stops; + VGint *ramp_stopsi; + VGint num_stops; + + VGboolean color_ramps_premultiplied; + } gradient; + + struct { + struct pipe_texture *texture; + VGTilingMode tiling_mode; + struct pipe_sampler_state sampler; + } pattern; + + struct pipe_constant_buffer cbuf; + struct pipe_shader_state fs_state; + void *fs; +}; + +static INLINE VGuint mix_pixels(VGuint p1, VGuint a, VGuint p2, VGuint b) +{ + VGuint t = (p1 & 0xff00ff) * a + (p2 & 0xff00ff) * b; + t >>= 8; t &= 0xff00ff; + + p1 = ((p1 >> 8) & 0xff00ff) * a + ((p2 >> 8) & 0xff00ff) * b; + p1 &= 0xff00ff00; p1 |= t; + + return p1; +} + +static INLINE VGuint float4_to_argb(const VGfloat *clr) +{ + return float_to_ubyte(clr[3]) << 24 | + float_to_ubyte(clr[0]) << 16 | + float_to_ubyte(clr[1]) << 8 | + float_to_ubyte(clr[2]) << 0; +} + +static INLINE void create_gradient_data(const VGfloat *ramp_stops, + VGint num, + VGuint *data, + VGint size) +{ + VGint i; + VGint pos = 0; + VGfloat fpos = 0, incr = 1.f / size; + VGuint last_color; + + while (fpos < ramp_stops[0]) { + data[pos] = float4_to_argb(ramp_stops + 1); + fpos += incr; + ++pos; + } + + for (i = 0; i < num - 1; ++i) { + VGint rcur = 5 * i; + VGint rnext = 5 * (i + 1); + VGfloat delta = 1.f/(ramp_stops[rnext] - ramp_stops[rcur]); + while (fpos < ramp_stops[rnext] && pos < size) { + VGint dist = 256 * ((fpos - ramp_stops[rcur]) * delta); + VGint idist = 256 - dist; + VGuint current_color = float4_to_argb(ramp_stops + rcur + 1); + VGuint next_color = float4_to_argb(ramp_stops + rnext + 1); + data[pos] = mix_pixels(current_color, idist, + next_color, dist); + fpos += incr; + ++pos; + } + } + + last_color = float4_to_argb(ramp_stops + ((num - 1) * 5 + 1)); + while (pos < size) { + data[pos] = last_color; + ++pos; + } + data[size-1] = last_color; +} + +static INLINE struct pipe_texture *create_gradient_texture(struct vg_paint *p) +{ + struct pipe_context *pipe = p->base.ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_texture *tex = 0; + struct pipe_texture templ; + + memset(&templ, 0, sizeof(templ)); + templ.target = PIPE_TEXTURE_1D; + templ.format = PIPE_FORMAT_A8R8G8B8_UNORM; + templ.last_level = 0; + templ.width[0] = 1024; + templ.height[0] = 1; + templ.depth[0] = 1; + pf_get_block(PIPE_FORMAT_A8R8G8B8_UNORM, &templ.block); + templ.tex_usage = PIPE_TEXTURE_USAGE_SAMPLER; + + tex = screen->texture_create(screen, &templ); + + { /* upload color_data */ + struct pipe_transfer *transfer = + st_no_flush_get_tex_transfer(p->base.ctx, tex, 0, 0, 0, + PIPE_TRANSFER_WRITE, 0, 0, 1024, 1); + void *map = screen->transfer_map(screen, transfer); + memcpy(map, p->gradient.color_data, sizeof(VGint)*1024); + screen->transfer_unmap(screen, transfer); + screen->tex_transfer_destroy(transfer); + } + + return tex; +} + +struct vg_paint * paint_create(struct vg_context *ctx) +{ + struct vg_paint *paint = CALLOC_STRUCT(vg_paint); + const VGfloat default_color[] = {0.0f, 0.0f, 0.0f, 1.0f}; + const VGfloat def_ling[] = {0.0f, 0.0f, 1.0f, 0.0f}; + const VGfloat def_radg[] = {0.0f, 0.0f, 0.0f, 0.0f, 1.0f}; + vg_init_object(&paint->base, ctx, VG_OBJECT_PAINT); + vg_context_add_object(ctx, VG_OBJECT_PAINT, paint); + + paint->type = VG_PAINT_TYPE_COLOR; + memcpy(paint->solid.color, default_color, + 4 * sizeof(VGfloat)); + paint->gradient.spread = VG_COLOR_RAMP_SPREAD_PAD; + memcpy(paint->gradient.linear.coords, def_ling, + 4 * sizeof(VGfloat)); + memcpy(paint->gradient.radial.vals, def_radg, + 5 * sizeof(VGfloat)); + + paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + paint->gradient.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + paint->gradient.sampler.min_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + paint->gradient.sampler.mag_img_filter = PIPE_TEX_MIPFILTER_NEAREST; + paint->gradient.sampler.normalized_coords = 1; + + memcpy(&paint->pattern.sampler, + &paint->gradient.sampler, + sizeof(struct pipe_sampler_state)); + + return paint; +} + +void paint_destroy(struct vg_paint *paint) +{ + struct vg_context *ctx = paint->base.ctx; + if (paint->pattern.texture) + pipe_texture_reference(&paint->pattern.texture, NULL); + if (ctx) + vg_context_remove_object(ctx, VG_OBJECT_PAINT, paint); + + free(paint->gradient.ramp_stopsi); + free(paint->gradient.ramp_stops); + free(paint); +} + +void paint_set_color(struct vg_paint *paint, + const VGfloat *color) +{ + paint->solid.color[0] = color[0]; + paint->solid.color[1] = color[1]; + paint->solid.color[2] = color[2]; + paint->solid.color[3] = color[3]; + + paint->solid.colori[0] = FLT_TO_INT(color[0]); + paint->solid.colori[1] = FLT_TO_INT(color[1]); + paint->solid.colori[2] = FLT_TO_INT(color[2]); + paint->solid.colori[3] = FLT_TO_INT(color[3]); +} + +static INLINE void paint_color_buffer(struct vg_paint *paint, void *buffer) +{ + VGfloat *map = (VGfloat*)buffer; + memcpy(buffer, paint->solid.color, 4 * sizeof(VGfloat)); + map[4] = 0.f; + map[5] = 1.f; + map[6] = 2.f; + map[7] = 4.f; +} + +static INLINE void paint_linear_gradient_buffer(struct vg_paint *paint, void *buffer) +{ + struct vg_context *ctx = paint->base.ctx; + VGfloat *map = (VGfloat*)buffer; + + map[0] = paint->gradient.linear.coords[2] - paint->gradient.linear.coords[0]; + map[1] = paint->gradient.linear.coords[3] - paint->gradient.linear.coords[1]; + map[2] = 1.f / (map[0] * map[0] + map[1] * map[1]); + map[3] = 1.f; + + map[4] = 0.f; + map[5] = 1.f; + map[6] = 2.f; + map[7] = 4.f; + { + struct matrix mat; + struct matrix inv; + matrix_load_identity(&mat); + matrix_translate(&mat, -paint->gradient.linear.coords[0], -paint->gradient.linear.coords[1]); + memcpy(&inv, &ctx->state.vg.fill_paint_to_user_matrix, + sizeof(struct matrix)); + matrix_invert(&inv); + matrix_mult(&inv, &mat); + memcpy(&mat, &inv, + sizeof(struct matrix)); + + map[8] = mat.m[0]; map[9] = mat.m[3]; map[10] = mat.m[6]; map[11] = 0.f; + map[12] = mat.m[1]; map[13] = mat.m[4]; map[14] = mat.m[7]; map[15] = 0.f; + map[16] = mat.m[2]; map[17] = mat.m[5]; map[18] = mat.m[8]; map[19] = 0.f; + } +#if 0 + debug_printf("Coords (%f, %f, %f, %f)\n", + map[0], map[1], map[2], map[3]); +#endif +} + + +static INLINE void paint_radial_gradient_buffer(struct vg_paint *paint, void *buffer) +{ + VGfloat *radialCoords = paint->gradient.radial.vals; + struct vg_context *ctx = paint->base.ctx; + + VGfloat *map = (VGfloat*)buffer; + + map[0] = radialCoords[0] - radialCoords[2]; + map[1] = radialCoords[1] - radialCoords[3]; + map[2] = -map[0] * map[0] - map[1] * map[1] + + radialCoords[4] * radialCoords[4]; + map[3] = 1.f; + + map[4] = 0.f; + map[5] = 1.f; + map[6] = 2.f; + map[7] = 4.f; + + { + struct matrix mat; + struct matrix inv; + matrix_load_identity(&mat); + matrix_translate(&mat, -radialCoords[2], -radialCoords[3]); + memcpy(&inv, &ctx->state.vg.fill_paint_to_user_matrix, + sizeof(struct matrix)); + matrix_invert(&inv); + matrix_mult(&inv, &mat); + memcpy(&mat, &inv, + sizeof(struct matrix)); + + map[8] = mat.m[0]; map[9] = mat.m[3]; map[10] = mat.m[6]; map[11] = 0.f; + map[12] = mat.m[1]; map[13] = mat.m[4]; map[14] = mat.m[7]; map[15] = 0.f; + map[16] = mat.m[2]; map[17] = mat.m[5]; map[18] = mat.m[8]; map[19] = 0.f; + } + +#if 0 + debug_printf("Coords (%f, %f, %f, %f)\n", + map[0], map[1], map[2], map[3]); +#endif +} + + +static INLINE void paint_pattern_buffer(struct vg_paint *paint, void *buffer) +{ + struct vg_context *ctx = paint->base.ctx; + + VGfloat *map = (VGfloat *)buffer; + memcpy(map, paint->solid.color, 4 * sizeof(VGfloat)); + + map[4] = 0.f; + map[5] = 1.f; + map[6] = paint->pattern.texture->width[0]; + map[7] = paint->pattern.texture->height[0]; + { + struct matrix mat; + memcpy(&mat, &ctx->state.vg.fill_paint_to_user_matrix, + sizeof(struct matrix)); + matrix_invert(&mat); + { + struct matrix pm; + memcpy(&pm, &ctx->state.vg.path_user_to_surface_matrix, + sizeof(struct matrix)); + matrix_invert(&pm); + matrix_mult(&pm, &mat); + memcpy(&mat, &pm, sizeof(struct matrix)); + } + + map[8] = mat.m[0]; map[9] = mat.m[3]; map[10] = mat.m[6]; map[11] = 0.f; + map[12] = mat.m[1]; map[13] = mat.m[4]; map[14] = mat.m[7]; map[15] = 0.f; + map[16] = mat.m[2]; map[17] = mat.m[5]; map[18] = mat.m[8]; map[19] = 0.f; + } +} + +void paint_set_type(struct vg_paint *paint, VGPaintType type) +{ + paint->type = type; +} + +void paint_set_ramp_stops(struct vg_paint *paint, const VGfloat *stops, + int num) +{ + const VGfloat default_stops[] = {0.0f, 0.0f, 0.0f, 0.0f, 1.0f, + 1.0f, 1.0f, 1.0f, 1.0f, 1.0f}; + VGint i; + const VGint num_stops = num / 5; + VGfloat last_coord; + + paint->gradient.num_stops = num; + if (num) { + free(paint->gradient.ramp_stops); + paint->gradient.ramp_stops = malloc(sizeof(VGfloat)*num); + memcpy(paint->gradient.ramp_stops, stops, sizeof(VGfloat)*num); + } else + return; + + /* stops must be in increasing order. the last stop is 1.0. if the + * first one is bigger than 1 then the whole sequence is invalid*/ + if (stops[0] > 1) { + stops = default_stops; + num = 10; + } + last_coord = stops[0]; + for (i = 1; i < num_stops; ++i) { + VGint idx = 5 * i; + VGfloat coord = stops[idx]; + if (!floatsEqual(last_coord, coord) && coord < last_coord) { + stops = default_stops; + num = 10; + break; + } + last_coord = coord; + } + + create_gradient_data(stops, num / 5, paint->gradient.color_data, + 1024); + + if (paint->gradient.texture) { + pipe_texture_reference(&paint->gradient.texture, NULL); + paint->gradient.texture = 0; + } + + paint->gradient.texture = create_gradient_texture(paint); +} + +void paint_set_colori(struct vg_paint *p, + VGuint rgba) +{ + p->solid.color[0] = ((rgba >> 24) & 0xff) / 255.f; + p->solid.color[1] = ((rgba >> 16) & 0xff) / 255.f; + p->solid.color[2] = ((rgba >> 8) & 0xff) / 255.f; + p->solid.color[3] = ((rgba >> 0) & 0xff) / 255.f; +} + +VGuint paint_colori(struct vg_paint *p) +{ +#define F2B(f) (float_to_ubyte(f)) + + return ((F2B(p->solid.color[0]) << 24) | + (F2B(p->solid.color[1]) << 16) | + (F2B(p->solid.color[2]) << 8) | + (F2B(p->solid.color[3]) << 0)); +#undef F2B +} + +void paint_set_linear_gradient(struct vg_paint *paint, + const VGfloat *coords) +{ + memcpy(paint->gradient.linear.coords, coords, sizeof(VGfloat) * 4); +} + +void paint_set_spread_mode(struct vg_paint *paint, + VGint mode) +{ + paint->gradient.spread = mode; + switch(mode) { + case VG_COLOR_RAMP_SPREAD_PAD: + paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + break; + case VG_COLOR_RAMP_SPREAD_REPEAT: + paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_REPEAT; + break; + case VG_COLOR_RAMP_SPREAD_REFLECT: + paint->gradient.sampler.wrap_s = PIPE_TEX_WRAP_MIRROR_REPEAT; + break; + } +} + +VGColorRampSpreadMode paint_spread_mode(struct vg_paint *paint) +{ + return paint->gradient.spread; +} + +void paint_set_radial_gradient(struct vg_paint *paint, + const VGfloat *values) +{ + memcpy(paint->gradient.radial.vals, values, sizeof(VGfloat) * 5); +} + +void paint_set_pattern(struct vg_paint *paint, + struct vg_image *img) +{ + if (paint->pattern.texture) + pipe_texture_reference(&paint->pattern.texture, NULL); + + paint->pattern.texture = 0; + pipe_texture_reference(&paint->pattern.texture, + img->texture); +} + +void paint_set_pattern_tiling(struct vg_paint *paint, + VGTilingMode mode) +{ + paint->pattern.tiling_mode = mode; + + switch(mode) { + case VG_TILE_FILL: + paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_BORDER; + paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_BORDER; + break; + case VG_TILE_PAD: + paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + break; + case VG_TILE_REPEAT: + paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_REPEAT; + paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_REPEAT; + break; + case VG_TILE_REFLECT: + paint->pattern.sampler.wrap_s = PIPE_TEX_WRAP_MIRROR_REPEAT; + paint->pattern.sampler.wrap_t = PIPE_TEX_WRAP_MIRROR_REPEAT; + break; + default: + debug_assert("!Unknown tiling mode"); + } +} + +void paint_get_color(struct vg_paint *paint, + VGfloat *color) +{ + color[0] = paint->solid.color[0]; + color[1] = paint->solid.color[1]; + color[2] = paint->solid.color[2]; + color[3] = paint->solid.color[3]; +} + +void paint_ramp_stops(struct vg_paint *paint, VGfloat *stops, + int num) +{ + memcpy(stops, paint->gradient.ramp_stops, sizeof(VGfloat)*num); +} + +void paint_linear_gradient(struct vg_paint *paint, + VGfloat *coords) +{ + memcpy(coords, paint->gradient.linear.coords, sizeof(VGfloat)*4); +} + +void paint_radial_gradient(struct vg_paint *paint, + VGfloat *coords) +{ + memcpy(coords, paint->gradient.radial.vals, sizeof(VGfloat)*5); +} + +int paint_num_ramp_stops(struct vg_paint *paint) +{ + return paint->gradient.num_stops; +} + +VGPaintType paint_type(struct vg_paint *paint) +{ + return paint->type; +} + +void paint_set_coloriv(struct vg_paint *paint, + const VGint *color) +{ + paint->solid.color[0] = color[0]; + paint->solid.color[1] = color[1]; + paint->solid.color[2] = color[2]; + paint->solid.color[3] = color[3]; + + paint->solid.colori[0] = color[0]; + paint->solid.colori[1] = color[1]; + paint->solid.colori[2] = color[2]; + paint->solid.colori[3] = color[3]; +} + +void paint_get_coloriv(struct vg_paint *paint, + VGint *color) +{ + color[0] = paint->solid.colori[0]; + color[1] = paint->solid.colori[1]; + color[2] = paint->solid.colori[2]; + color[3] = paint->solid.colori[3]; +} + +void paint_set_color_ramp_premultiplied(struct vg_paint *paint, + VGboolean set) +{ + paint->gradient.color_ramps_premultiplied = set; +} + +VGboolean paint_color_ramp_premultiplied(struct vg_paint *paint) +{ + return paint->gradient.color_ramps_premultiplied; +} + +void paint_set_ramp_stopsi(struct vg_paint *paint, const VGint *stops, + int num) +{ + if (num) { + free(paint->gradient.ramp_stopsi); + paint->gradient.ramp_stopsi = malloc(sizeof(VGint)*num); + memcpy(paint->gradient.ramp_stopsi, stops, sizeof(VGint)*num); + } +} + +void paint_ramp_stopsi(struct vg_paint *paint, VGint *stops, + int num) +{ + memcpy(stops, paint->gradient.ramp_stopsi, sizeof(VGint)*num); +} + +void paint_set_linear_gradienti(struct vg_paint *paint, + const VGint *coords) +{ + memcpy(paint->gradient.linear.coordsi, coords, sizeof(VGint) * 4); +} + +void paint_linear_gradienti(struct vg_paint *paint, + VGint *coords) +{ + memcpy(coords, paint->gradient.linear.coordsi, sizeof(VGint)*4); +} + +void paint_set_radial_gradienti(struct vg_paint *paint, + const VGint *values) +{ + memcpy(paint->gradient.radial.valsi, values, sizeof(VGint) * 5); +} + +void paint_radial_gradienti(struct vg_paint *paint, + VGint *coords) +{ + memcpy(coords, paint->gradient.radial.valsi, sizeof(VGint)*5); +} + +VGTilingMode paint_pattern_tiling(struct vg_paint *paint) +{ + return paint->pattern.tiling_mode; +} + +VGint paint_bind_samplers(struct vg_paint *paint, struct pipe_sampler_state **samplers, + struct pipe_texture **textures) +{ + struct vg_context *ctx = vg_current_context(); + + switch(paint->type) { + case VG_PAINT_TYPE_LINEAR_GRADIENT: + case VG_PAINT_TYPE_RADIAL_GRADIENT: { + if (paint->gradient.texture) { + paint->gradient.sampler.min_img_filter = image_sampler_filter(ctx); + paint->gradient.sampler.mag_img_filter = image_sampler_filter(ctx); + samplers[0] = &paint->gradient.sampler; + textures[0] = paint->gradient.texture; + return 1; + } + } + break; + case VG_PAINT_TYPE_PATTERN: { + memcpy(paint->pattern.sampler.border_color, + ctx->state.vg.tile_fill_color, + sizeof(VGfloat) * 4); + paint->pattern.sampler.min_img_filter = image_sampler_filter(ctx); + paint->pattern.sampler.mag_img_filter = image_sampler_filter(ctx); + samplers[0] = &paint->pattern.sampler; + textures[0] = paint->pattern.texture; + return 1; + } + break; + default: + samplers[0] = &paint->pattern.sampler; /* dummy */ + textures[0] = 0; + return 0; + break; + } + return 0; +} + +void paint_resolve_type(struct vg_paint *paint) +{ + if (paint->type == VG_PAINT_TYPE_PATTERN && + !paint->pattern.texture) { + paint->type = VG_PAINT_TYPE_COLOR; + } +} + +VGint paint_constant_buffer_size(struct vg_paint *paint) +{ + switch(paint->type) { + case VG_PAINT_TYPE_COLOR: + return 8 * sizeof(VGfloat);/*4 color + 4 constants (0.f,1.f,2.f,4.f)*/ + break; + case VG_PAINT_TYPE_LINEAR_GRADIENT: + return 20 * sizeof(VGfloat); + break; + case VG_PAINT_TYPE_RADIAL_GRADIENT: + return 20 * sizeof(VGfloat); + break; + case VG_PAINT_TYPE_PATTERN: + return 20 * sizeof(VGfloat); + break; + default: + debug_printf("Uknown paint type: %d\n", paint->type); + } + + return 0; +} + +void paint_fill_constant_buffer(struct vg_paint *paint, + void *buffer) +{ + switch(paint->type) { + case VG_PAINT_TYPE_COLOR: + paint_color_buffer(paint, buffer); + break; + case VG_PAINT_TYPE_LINEAR_GRADIENT: + paint_linear_gradient_buffer(paint, buffer); + break; + case VG_PAINT_TYPE_RADIAL_GRADIENT: + paint_radial_gradient_buffer(paint, buffer); + break; + case VG_PAINT_TYPE_PATTERN: + paint_pattern_buffer(paint, buffer); + break; + + default: + abort(); + } +} diff --git a/src/gallium/state_trackers/vega/paint.h b/src/gallium/state_trackers/vega/paint.h new file mode 100644 index 0000000000..999b5c167c --- /dev/null +++ b/src/gallium/state_trackers/vega/paint.h @@ -0,0 +1,118 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef PAINT_H +#define PAINT_H + +#include "vg_context.h" + +#include "VG/openvg.h" +#include "pipe/p_state.h" + +struct vg_paint; +struct vg_image; +struct pipe_sampler_state; +struct pipe_texture; + +struct vg_paint *paint_create(struct vg_context *ctx); +void paint_destroy(struct vg_paint *paint); + +void paint_set_color(struct vg_paint *paint, + const VGfloat *color); +void paint_get_color(struct vg_paint *paint, + VGfloat *color); + +void paint_set_coloriv(struct vg_paint *paint, + const VGint *color); +void paint_get_coloriv(struct vg_paint *paint, + VGint *color); + +void paint_set_colori(struct vg_paint *paint, + VGuint rgba); + +VGuint paint_colori(struct vg_paint *paint); + +void paint_set_type(struct vg_paint *paint, VGPaintType type); +VGPaintType paint_type(struct vg_paint *paint); +void paint_resolve_type(struct vg_paint *paint); + +void paint_set_linear_gradient(struct vg_paint *paint, + const VGfloat *coords); +void paint_linear_gradient(struct vg_paint *paint, + VGfloat *coords); +void paint_set_linear_gradienti(struct vg_paint *paint, + const VGint *coords); +void paint_linear_gradienti(struct vg_paint *paint, + VGint *coords); + + +void paint_set_radial_gradient(struct vg_paint *paint, + const VGfloat *values); +void paint_radial_gradient(struct vg_paint *paint, + VGfloat *coords); +void paint_set_radial_gradienti(struct vg_paint *paint, + const VGint *values); +void paint_radial_gradienti(struct vg_paint *paint, + VGint *coords); + + +void paint_set_ramp_stops(struct vg_paint *paint, const VGfloat *stops, + int num); +void paint_ramp_stops(struct vg_paint *paint, VGfloat *stops, + int num); + +void paint_set_ramp_stopsi(struct vg_paint *paint, const VGint *stops, + int num); +void paint_ramp_stopsi(struct vg_paint *paint, VGint *stops, + int num); + +int paint_num_ramp_stops(struct vg_paint *paint); + +void paint_set_spread_mode(struct vg_paint *paint, + VGint mode); +VGColorRampSpreadMode paint_spread_mode(struct vg_paint *paint); + + +void paint_set_pattern(struct vg_paint *paint, + struct vg_image *img); +void paint_set_pattern_tiling(struct vg_paint *paint, + VGTilingMode mode); +VGTilingMode paint_pattern_tiling(struct vg_paint *paint); + +void paint_set_color_ramp_premultiplied(struct vg_paint *paint, + VGboolean set); +VGboolean paint_color_ramp_premultiplied(struct vg_paint *paint); + + +VGint paint_bind_samplers(struct vg_paint *paint, struct pipe_sampler_state **samplers, + struct pipe_texture **textures); + +VGint paint_constant_buffer_size(struct vg_paint *paint); +void paint_fill_constant_buffer(struct vg_paint *paint, + void *buffer); + + +#endif diff --git a/src/gallium/state_trackers/vega/path.c b/src/gallium/state_trackers/vega/path.c new file mode 100644 index 0000000000..d04f9d9ae6 --- /dev/null +++ b/src/gallium/state_trackers/vega/path.c @@ -0,0 +1,2034 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "path.h" + +#include "stroker.h" +#include "polygon.h" +#include "bezier.h" +#include "matrix.h" +#include "vg_context.h" +#include "util_array.h" +#include "arc.h" +#include "path_utils.h" +#include "paint.h" +#include "shader.h" + +#include "util/u_memory.h" + +#include <assert.h> + +#define DEBUG_PATH 0 + +struct path { + struct vg_object base; + VGbitfield caps; + VGboolean dirty; + VGboolean dirty_stroke; + + VGPathDatatype datatype; + + VGfloat scale; + VGfloat bias; + + VGint num_segments; + + struct array * segments; + struct array * control_points; + + struct { + struct polygon_array polygon_array; + struct matrix matrix; + } fill_polys; + + struct { + struct path *path; + struct matrix matrix; + VGfloat stroke_width; + VGfloat miter_limit; + VGCapStyle cap_style; + VGJoinStyle join_style; + } stroked; +}; + + +static INLINE void data_at(void **data, + struct path *p, + VGint start, VGint count, + VGfloat *out) +{ + VGPathDatatype dt = p->datatype; + VGint i; + VGint end = start + count; + VGfloat *itr = out; + + switch(dt) { + case VG_PATH_DATATYPE_S_8: { + VGbyte **bdata = (VGbyte **)data; + for (i = start; i < end; ++i) { + *itr = (*bdata)[i]; + ++itr; + } + *bdata += count; + } + break; + case VG_PATH_DATATYPE_S_16: { + VGshort **bdata = (VGshort **)data; + for (i = start; i < end; ++i) { + *itr = (*bdata)[i]; + ++itr; + } + *bdata += count; + } + break; + case VG_PATH_DATATYPE_S_32: { + VGint **bdata = (VGint **)data; + for (i = start; i < end; ++i) { + *itr = (*bdata)[i]; + ++itr; + } + *bdata += count; + } + break; + case VG_PATH_DATATYPE_F: { + VGfloat **fdata = (VGfloat **)data; + for (i = start; i < end; ++i) { + *itr = (*fdata)[i]; + ++itr; + } + *fdata += count; + } + break; + default: + debug_assert(!"Unknown path datatype!"); + } +} + + +void vg_float_to_datatype(VGPathDatatype datatype, + VGubyte *common_data, + const VGfloat *data, + VGint num_coords) +{ + VGint i; + switch(datatype) { + case VG_PATH_DATATYPE_S_8: { + for (i = 0; i < num_coords; ++i) { + common_data[i] = (VGubyte)data[i]; + } + } + break; + case VG_PATH_DATATYPE_S_16: { + VGshort *buf = (VGshort*)common_data; + for (i = 0; i < num_coords; ++i) { + buf[i] = (VGshort)data[i]; + } + } + break; + case VG_PATH_DATATYPE_S_32: { + VGint *buf = (VGint*)common_data; + for (i = 0; i < num_coords; ++i) { + buf[i] = (VGint)data[i]; + } + } + break; + case VG_PATH_DATATYPE_F: { + memcpy(common_data, data, sizeof(VGfloat) * num_coords); + } + break; + default: + debug_assert(!"Unknown path datatype!"); + } +} + +static void coords_adjust_by_scale_bias(struct path *p, + void *pdata, VGint num_coords, + VGfloat scale, VGfloat bias, + VGPathDatatype datatype) +{ + VGfloat data[8]; + void *coords = (VGfloat *)pdata; + VGubyte *common_data = (VGubyte *)pdata; + VGint size_dst = size_for_datatype(datatype); + VGint i; + + for (i = 0; i < num_coords; ++i) { + data_at(&coords, p, 0, 1, data); + data[0] = data[0] * scale + bias; + vg_float_to_datatype(datatype, common_data, data, 1); + common_data += size_dst; + } +} + +struct path * path_create(VGPathDatatype dt, VGfloat scale, VGfloat bias, + VGint segmentCapacityHint, + VGint coordCapacityHint, + VGbitfield capabilities) +{ + struct path *path = CALLOC_STRUCT(path); + + vg_init_object(&path->base, vg_current_context(), VG_OBJECT_PATH); + path->caps = capabilities & VG_PATH_CAPABILITY_ALL; + vg_context_add_object(vg_current_context(), VG_OBJECT_PATH, path); + + path->datatype = dt; + path->scale = scale; + path->bias = bias; + + path->segments = array_create(size_for_datatype(VG_PATH_DATATYPE_S_8)); + path->control_points = array_create(size_for_datatype(dt)); + + path->dirty = VG_TRUE; + path->dirty_stroke = VG_TRUE; + + return path; +} + +void path_destroy(struct path *p) +{ + vg_context_remove_object(vg_current_context(), VG_OBJECT_PATH, p); + + array_destroy(p->segments); + array_destroy(p->control_points); + array_destroy(p->fill_polys.polygon_array.array); + + if (p->stroked.path) + path_destroy(p->stroked.path); + + free(p); +} + +VGbitfield path_capabilities(struct path *p) +{ + return p->caps; +} + +void path_set_capabilities(struct path *p, VGbitfield bf) +{ + p->caps = (bf & VG_PATH_CAPABILITY_ALL); +} + +void path_append_data(struct path *p, + VGint numSegments, + const VGubyte * pathSegments, + const void * pathData) +{ + VGint old_segments = p->num_segments; + VGint num_new_coords = num_elements_for_segments(pathSegments, numSegments); + array_append_data(p->segments, pathSegments, numSegments); + array_append_data(p->control_points, pathData, num_new_coords); + + p->num_segments += numSegments; + if (!floatsEqual(p->scale, 1.f) || !floatsEqual(p->bias, 0.f)) { + VGubyte *coords = (VGubyte*)p->control_points->data; + coords_adjust_by_scale_bias(p, + coords + old_segments * p->control_points->datatype_size, + num_new_coords, + p->scale, p->bias, p->datatype); + } + p->dirty = VG_TRUE; + p->dirty_stroke = VG_TRUE; +} + +VGint path_num_segments(struct path *p) +{ + return p->num_segments; +} + +static INLINE void map_if_relative(VGfloat ox, VGfloat oy, + VGboolean relative, + VGfloat *x, VGfloat *y) +{ + if (relative) { + if (x) + *x += ox; + if (y) + *y += oy; + } +} + +static INLINE void close_polygon(struct polygon *current, + VGfloat sx, VGfloat sy, + VGfloat ox, VGfloat oy, + struct matrix *matrix) +{ + if (!floatsEqual(sx, ox) || + !floatsEqual(sy, oy)) { + VGfloat x0 = sx; + VGfloat y0 = sy; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + } +} + +static void convert_path(struct path *p, + VGPathDatatype to, + void *dst, + VGint num_coords) +{ + VGfloat data[8]; + void *coords = (VGfloat *)p->control_points->data; + VGubyte *common_data = (VGubyte *)dst; + VGint size_dst = size_for_datatype(to); + VGint i; + + for (i = 0; i < num_coords; ++i) { + data_at(&coords, p, 0, 1, data); + vg_float_to_datatype(to, common_data, data, 1); + common_data += size_dst; + } +} + + +static void polygon_array_calculate_bounds( struct polygon_array *polyarray ) +{ + struct array *polys = polyarray->array; + VGfloat min_x, max_x; + VGfloat min_y, max_y; + VGfloat bounds[4]; + unsigned i; + + assert(polys); + assert(polys->num_elements); + polygon_bounding_rect((((struct polygon**)polys->data)[0]), bounds); + min_x = bounds[0]; + min_y = bounds[1]; + max_x = bounds[0] + bounds[2]; + max_y = bounds[1] + bounds[3]; + for (i = 1; i < polys->num_elements; ++i) { + struct polygon *p = (((struct polygon**)polys->data)[i]); + polygon_bounding_rect(p, bounds); + min_x = MIN2(min_x, bounds[0]); + min_y = MIN2(min_y, bounds[1]); + max_x = MAX2(max_x, bounds[0] + bounds[2]); + max_y = MAX2(max_y, bounds[1] + bounds[3]); + } + + polyarray->min_x = min_x; + polyarray->min_y = min_y; + polyarray->max_x = max_x; + polyarray->max_y = max_y; +} + + +static struct polygon_array * path_get_fill_polygons(struct path *p, struct matrix *matrix) +{ + VGint i; + struct polygon *current = 0; + VGfloat sx, sy, px, py, ox, oy; + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + VGfloat data[8]; + void *coords = (VGfloat *)p->control_points->data; + struct array *array; + + if (p->fill_polys.polygon_array.array) + { + if (memcmp( &p->fill_polys.matrix, + matrix, + sizeof *matrix ) == 0 && p->dirty == VG_FALSE) + { + return &p->fill_polys.polygon_array; + } + else { + array_destroy( p->fill_polys.polygon_array.array ); + p->fill_polys.polygon_array.array = NULL; + } + } + + array = array_create(sizeof(struct array*)); + + sx = sy = px = py = ox = oy = 0.f; + + current = polygon_create(32); + + for (i = 0; i < p->num_segments; ++i) { + VGubyte segment = ((VGubyte*)(p->segments->data))[i]; + VGint command = SEGMENT_COMMAND(segment); + VGboolean relative = SEGMENT_ABS_REL(segment); + + switch(command) { + case VG_CLOSE_PATH: + close_polygon(current, sx, sy, ox, oy, matrix); + ox = sx; + oy = sy; + break; + case VG_MOVE_TO: + if (current && polygon_vertex_count(current) > 0) { + /* add polygon */ + close_polygon(current, sx, sy, ox, oy, matrix); + array_append_data(array, ¤t, 1); + current = polygon_create(32); + } + data_at(&coords, p, 0, 2, data); + x0 = data[0]; + y0 = data[1]; + map_if_relative(ox, oy, relative, &x0, &y0); + sx = x0; + sy = y0; + ox = x0; + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + break; + case VG_LINE_TO: + data_at(&coords, p, 0, 2, data); + x0 = data[0]; + y0 = data[1]; + map_if_relative(ox, oy, relative, &x0, &y0); + ox = x0; + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + break; + case VG_HLINE_TO: + data_at(&coords, p, 0, 1, data); + x0 = data[0]; + y0 = oy; + map_if_relative(ox, oy, relative, &x0, 0); + ox = x0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + break; + case VG_VLINE_TO: + data_at(&coords, p, 0, 1, data); + x0 = ox; + y0 = data[0]; + map_if_relative(ox, oy, relative, 0, &y0); + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + polygon_vertex_append(current, x0, y0); + break; + case VG_CUBIC_TO: { + struct bezier bezier; + data_at(&coords, p, 0, 6, data); + x0 = ox; + y0 = oy; + x1 = data[0]; + y1 = data[1]; + x2 = data[2]; + y2 = data[3]; + x3 = data[4]; + y3 = data[5]; + map_if_relative(ox, oy, relative, &x1, &y1); + map_if_relative(ox, oy, relative, &x2, &y2); + map_if_relative(ox, oy, relative, &x3, &y3); + ox = x3; + oy = y3; + px = x2; + py = y2; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + bezier_init(&bezier, x0, y0, x1, y1, + x2, y2, x3, y3); + bezier_add_to_polygon(&bezier, current); + } + break; + case VG_QUAD_TO: { + struct bezier bezier; + data_at(&coords, p, 0, 4, data); + x0 = ox; + y0 = oy; + x1 = data[0]; + y1 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(ox, oy, relative, &x1, &y1); + map_if_relative(ox, oy, relative, &x3, &y3); + px = x1; + py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + ox = x3; + oy = y3; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + bezier_init(&bezier, x0, y0, x1, y1, + x2, y2, x3, y3); + bezier_add_to_polygon(&bezier, current); + } + break; + case VG_SQUAD_TO: { + struct bezier bezier; + data_at(&coords, p, 0, 2, data); + x0 = ox; + y0 = oy; + x1 = 2*ox-px; + y1 = 2*oy-py; + x3 = data[0]; + y3 = data[1]; + map_if_relative(ox, oy, relative, &x3, &y3); + px = x1; + py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + ox = x3; + oy = y3; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + bezier_init(&bezier, x0, y0, x1, y1, + x2, y2, x3, y3); + bezier_add_to_polygon(&bezier, current); + } + break; + case VG_SCUBIC_TO: { + struct bezier bezier; + data_at(&coords, p, 0, 4, data); + x0 = ox; + y0 = oy; + x1 = 2*ox-px; + y1 = 2*oy-py; + x2 = data[0]; + y2 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(ox, oy, relative, &x2, &y2); + map_if_relative(ox, oy, relative, &x3, &y3); + ox = x3; + oy = y3; + px = x2; + py = y2; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + bezier_init(&bezier, x0, y0, x1, y1, + x2, y2, x3, y3); + bezier_add_to_polygon(&bezier, current); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + VGfloat rh, rv, rot; + struct arc arc; + + data_at(&coords, p, 0, 5, data); + x0 = ox; + y0 = oy; + rh = data[0]; + rv = data[1]; + rot = data[2]; + x1 = data[3]; + y1 = data[4]; + map_if_relative(ox, oy, relative, &x1, &y1); +#if 0 + debug_printf("------- ARC (%f, %f), (%f, %f) %f, %f, %f\n", + x0, y0, x1, y1, rh, rv, rot); +#endif + arc_init(&arc, command, x0, y0, x1, y1, + rh, rv, rot); + arc_add_to_polygon(&arc, current, + matrix); + ox = x1; + oy = y1; + px = x1; + py = y1; + } + break; + default: + abort(); + assert(!"Unknown segment!"); + } + } + if (current) { + if (polygon_vertex_count(current) > 0) { + close_polygon(current, sx, sy, ox, oy, matrix); + array_append_data(array, ¤t, 1); + } else + polygon_destroy(current); + } + + p->fill_polys.polygon_array.array = array; + p->fill_polys.matrix = *matrix; + + polygon_array_calculate_bounds( &p->fill_polys.polygon_array ); + + p->dirty = VG_FALSE; + + return &p->fill_polys.polygon_array; +} + +VGbyte path_datatype_size(struct path *p) +{ + return size_for_datatype(p->datatype); +} + +VGPathDatatype path_datatype(struct path *p) +{ + return p->datatype; +} + +VGfloat path_scale(struct path *p) +{ + return p->scale; +} + +VGfloat path_bias(struct path *p) +{ + return p->bias; +} + +VGint path_num_coords(struct path *p) +{ + return num_elements_for_segments((VGubyte*)p->segments->data, + p->num_segments); +} + +void path_modify_coords(struct path *p, + VGint startIndex, + VGint numSegments, + const void * pathData) +{ + VGubyte *segments = (VGubyte*)(p->segments->data); + VGint count = num_elements_for_segments(&segments[startIndex], numSegments); + VGint start_cp = num_elements_for_segments(segments, startIndex); + + array_change_data(p->control_points, pathData, start_cp, count); + coords_adjust_by_scale_bias(p, + ((VGubyte*)p->control_points->data) + + (startIndex * p->control_points->datatype_size), + path_num_coords(p), + p->scale, p->bias, p->datatype); + p->dirty = VG_TRUE; + p->dirty_stroke = VG_TRUE; +} + +void path_for_each_segment(struct path *path, + path_for_each_cb cb, + void *user_data) +{ + VGint i; + struct path_for_each_data p; + VGfloat data[8]; + void *coords = (VGfloat *)path->control_points->data; + + p.coords = data; + p.sx = p.sy = p.px = p.py = p.ox = p.oy = 0.f; + p.user_data = user_data; + + for (i = 0; i < path->num_segments; ++i) { + VGint command; + VGboolean relative; + + p.segment = ((VGubyte*)(path->segments->data))[i]; + command = SEGMENT_COMMAND(p.segment); + relative = SEGMENT_ABS_REL(p.segment); + + switch(command) { + case VG_CLOSE_PATH: + cb(path, &p); + break; + case VG_MOVE_TO: + data_at(&coords, path, 0, 2, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + cb(path, &p); + p.sx = data[0]; + p.sy = data[1]; + p.ox = data[0]; + p.oy = data[1]; + p.px = data[0]; + p.py = data[1]; + break; + case VG_LINE_TO: + data_at(&coords, path, 0, 2, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + cb(path, &p); + p.ox = data[0]; + p.oy = data[1]; + p.px = data[0]; + p.py = data[1]; + break; + case VG_HLINE_TO: + data_at(&coords, path, 0, 1, data); + map_if_relative(p.ox, p.oy, relative, &data[0], 0); + p.segment = VG_LINE_TO; + data[1] = p.oy; + cb(path, &p); + p.ox = data[0]; + p.oy = data[1]; + p.px = data[0]; + p.py = data[1]; + break; + case VG_VLINE_TO: + data_at(&coords, path, 0, 1, data); + map_if_relative(p.ox, p.oy, relative, 0, &data[0]); + p.segment = VG_LINE_TO; + data[1] = data[0]; + data[0] = p.ox; + cb(path, &p); + p.ox = data[0]; + p.oy = data[1]; + p.px = data[0]; + p.py = data[1]; + break; + case VG_CUBIC_TO: { + data_at(&coords, path, 0, 6, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + map_if_relative(p.ox, p.oy, relative, &data[2], &data[3]); + map_if_relative(p.ox, p.oy, relative, &data[4], &data[5]); + cb(path, &p); + p.px = data[2]; + p.py = data[3]; + p.ox = data[4]; + p.oy = data[5]; + } + break; + case VG_QUAD_TO: { + data_at(&coords, path, 0, 4, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + map_if_relative(p.ox, p.oy, relative, &data[2], &data[3]); + cb(path, &p); + p.px = data[0]; + p.py = data[1]; + p.ox = data[2]; + p.oy = data[3]; + } + break; + case VG_SQUAD_TO: { + data_at(&coords, path, 0, 2, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + cb(path, &p); + p.px = 2*p.ox-p.px; + p.py = 2*p.oy-p.py; + p.ox = data[2]; + p.oy = data[3]; + } + break; + case VG_SCUBIC_TO: { + data_at(&coords, path, 0, 4, data); + map_if_relative(p.ox, p.oy, relative, &data[0], &data[1]); + map_if_relative(p.ox, p.oy, relative, &data[2], &data[3]); + cb(path, &p); + p.px = data[0]; + p.py = data[1]; + p.ox = data[2]; + p.oy = data[3]; + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + data_at(&coords, path, 0, 5, data); + map_if_relative(p.ox, p.oy, relative, &data[3], &data[4]); +#if 0 + debug_printf("------- ARC (%f, %f), (%f, %f) %f, %f, %f\n", + p.ox, p.oy, data[3], data[4], data[0], data[1], data[2]); +#endif + cb(path, &p); + p.ox = data[3]; + p.oy = data[4]; + p.px = data[3]; + p.py = data[4]; + } + break; + default: + abort(); + assert(!"Unknown segment!"); + } + } +} + +struct transform_data { + struct array *segments; + struct array *coords; + + struct matrix *matrix; + + VGPathDatatype datatype; +}; + +static VGboolean transform_cb(struct path *p, + struct path_for_each_data *pd) +{ + struct transform_data *td = (struct transform_data *)pd->user_data; + VGint num_coords = num_elements_for_segments(&pd->segment, 1); + VGubyte segment = SEGMENT_COMMAND(pd->segment);/* abs bit is 0 */ + VGfloat data[8]; + VGubyte common_data[sizeof(VGfloat)*8]; + + memcpy(data, pd->coords, sizeof(VGfloat) * num_coords); + + switch(segment) { + case VG_CLOSE_PATH: + break; + case VG_MOVE_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + break; + case VG_LINE_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + break; + case VG_HLINE_TO: + case VG_VLINE_TO: + assert(0); + break; + case VG_QUAD_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + matrix_map_point(td->matrix, + data[2], data[3], &data[2], &data[3]); + break; + case VG_CUBIC_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + matrix_map_point(td->matrix, + data[2], data[3], &data[2], &data[3]); + matrix_map_point(td->matrix, + data[4], data[5], &data[4], &data[5]); + break; + case VG_SQUAD_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + break; + case VG_SCUBIC_TO: + matrix_map_point(td->matrix, + data[0], data[1], &data[0], &data[1]); + matrix_map_point(td->matrix, + data[2], data[3], &data[2], &data[3]); + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct path *path = path_create(td->datatype, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + arc_init(&arc, segment, + pd->ox, pd->oy, data[3], data[4], + data[0], data[1], data[2]); + + arc_to_path(&arc, path, td->matrix); + + num_coords = path_num_coords(path); + + array_append_data(td->segments, path->segments->data, + path->num_segments); + array_append_data(td->coords, path->control_points->data, + num_coords); + path_destroy(path); + + return VG_TRUE; + } + break; + default: + break; + } + + vg_float_to_datatype(td->datatype, common_data, data, num_coords); + + array_append_data(td->segments, &segment, 1); + array_append_data(td->coords, common_data, num_coords); + return VG_TRUE; +} + +void path_transform(struct path *dst, struct path *src) +{ + struct transform_data data; + struct vg_context *ctx = dst->base.ctx; + + data.segments = dst->segments; + data.coords = dst->control_points; + data.matrix = &ctx->state.vg.path_user_to_surface_matrix; + data.datatype = dst->datatype; + + path_for_each_segment(src, transform_cb, (void*)&data); + + dst->num_segments = dst->segments->num_elements; + dst->dirty = VG_TRUE; + dst->dirty_stroke = VG_TRUE; +} + +void path_append_path(struct path *dst, + struct path *src) +{ + VGint num_coords = path_num_coords(src); + void *dst_data = malloc(size_for_datatype(dst->datatype) * num_coords); + array_append_data(dst->segments, + src->segments->data, + src->num_segments); + convert_path(src, dst->datatype, + dst_data, num_coords); + array_append_data(dst->control_points, + dst_data, + num_coords); + free(dst_data); + + dst->num_segments += src->num_segments; + dst->dirty = VG_TRUE; + dst->dirty_stroke = VG_TRUE; +} + +static INLINE VGboolean is_segment_arc(VGubyte segment) +{ + VGubyte scommand = SEGMENT_COMMAND(segment); + return (scommand == VG_SCCWARC_TO || + scommand == VG_SCWARC_TO || + scommand == VG_LCCWARC_TO || + scommand == VG_LCWARC_TO); +} + +struct path_iter_data { + struct path *path; + VGubyte segment; + void *coords; + VGfloat px, py, ox, oy, sx, sy; +}; +static INLINE VGubyte normalize_coords(struct path_iter_data *pd, + VGint *num_coords, + VGfloat *data) +{ + VGint command = SEGMENT_COMMAND(pd->segment); + VGboolean relative = SEGMENT_ABS_REL(pd->segment); + + switch(command) { + case VG_CLOSE_PATH: + *num_coords = 0; + pd->ox = pd->sx; + pd->oy = pd->sy; + return VG_CLOSE_PATH; + break; + case VG_MOVE_TO: + data_at(&pd->coords, pd->path, 0, 2, data); + map_if_relative(pd->ox, pd->oy, relative, &data[0], &data[1]); + pd->sx = data[0]; + pd->sy = data[1]; + pd->ox = data[0]; + pd->oy = data[1]; + pd->px = data[0]; + pd->py = data[1]; + *num_coords = 2; + return VG_MOVE_TO_ABS; + break; + case VG_LINE_TO: + data_at(&pd->coords, pd->path, 0, 2, data); + map_if_relative(pd->ox, pd->oy, relative, &data[0], &data[1]); + pd->ox = data[0]; + pd->oy = data[1]; + pd->px = data[0]; + pd->py = data[1]; + *num_coords = 2; + return VG_LINE_TO_ABS; + break; + case VG_HLINE_TO: + data_at(&pd->coords, pd->path, 0, 1, data); + map_if_relative(pd->ox, pd->oy, relative, &data[0], 0); + data[1] = pd->oy; + pd->ox = data[0]; + pd->oy = data[1]; + pd->px = data[0]; + pd->py = data[1]; + *num_coords = 2; + return VG_LINE_TO_ABS; + break; + case VG_VLINE_TO: + data_at(&pd->coords, pd->path, 0, 1, data); + map_if_relative(pd->ox, pd->oy, relative, 0, &data[0]); + data[1] = data[0]; + data[0] = pd->ox; + pd->ox = data[0]; + pd->oy = data[1]; + pd->px = data[0]; + pd->py = data[1]; + *num_coords = 2; + return VG_LINE_TO_ABS; + break; + case VG_CUBIC_TO: { + data_at(&pd->coords, pd->path, 0, 6, data); + map_if_relative(pd->ox, pd->oy, relative, &data[0], &data[1]); + map_if_relative(pd->ox, pd->oy, relative, &data[2], &data[3]); + map_if_relative(pd->ox, pd->oy, relative, &data[4], &data[5]); + pd->px = data[2]; + pd->py = data[3]; + pd->ox = data[4]; + pd->oy = data[5]; + *num_coords = 6; + return VG_CUBIC_TO_ABS; + } + break; + case VG_QUAD_TO: { + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + data_at(&pd->coords, pd->path, 0, 4, data); + x0 = pd->ox; + y0 = pd->oy; + x1 = data[0]; + y1 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(pd->ox, pd->oy, relative, &x1, &y1); + map_if_relative(pd->ox, pd->oy, relative, &x3, &y3); + pd->px = x1; + pd->py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + pd->ox = x3; + pd->oy = y3; + data[0] = x1; + data[1] = y1; + data[2] = x2; + data[3] = y2; + data[4] = x3; + data[5] = y3; + *num_coords = 6; + return VG_CUBIC_TO_ABS; + } + break; + case VG_SQUAD_TO: { + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + data_at(&pd->coords, pd->path, 0, 2, data); + x0 = pd->ox; + y0 = pd->oy; + x1 = 2 * pd->ox - pd->px; + y1 = 2 * pd->oy - pd->py; + x3 = data[0]; + y3 = data[1]; + map_if_relative(pd->ox, pd->oy, relative, &x3, &y3); + pd->px = x1; + pd->py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + pd->ox = x3; + pd->oy = y3; + data[0] = x1; + data[1] = y1; + data[2] = x2; + data[3] = y2; + data[4] = x3; + data[5] = y3; + *num_coords = 6; + return VG_CUBIC_TO_ABS; + } + break; + case VG_SCUBIC_TO: { + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + data_at(&pd->coords, pd->path, 0, 4, data); + x0 = pd->ox; + y0 = pd->oy; + x1 = 2*pd->ox-pd->px; + y1 = 2*pd->oy-pd->py; + x2 = data[0]; + y2 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(pd->ox, pd->oy, relative, &x2, &y2); + map_if_relative(pd->ox, pd->oy, relative, &x3, &y3); + pd->ox = x3; + pd->oy = y3; + pd->px = x2; + pd->py = y2; + data[0] = x1; + data[1] = y1; + data[2] = x2; + data[3] = y2; + data[4] = x3; + data[5] = y3; + *num_coords = 6; + return VG_CUBIC_TO_ABS; + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + data_at(&pd->coords, pd->path, 0, 5, data); + map_if_relative(pd->ox, pd->oy, relative, &data[3], &data[4]); + pd->ox = data[3]; + pd->oy = data[4]; + pd->px = data[3]; + pd->py = data[4]; + *num_coords = 5; + return command | VG_ABSOLUTE; + } + break; + default: + abort(); + assert(!"Unknown segment!"); + } +} + +static void linearly_interpolate(VGfloat *result, + const VGfloat *start, + const VGfloat *end, + VGfloat amount, + VGint number) +{ + VGint i; + for (i = 0; i < number; ++i) { + result[i] = start[i] + (end[i] - start[i]) * amount; + } +} + +VGboolean path_interpolate(struct path *dst, + struct path *start, struct path *end, + VGfloat amount) +{ + /* temporary path that we can discard if it will turn + * out that start is not compatible with end */ + struct path *res_path = path_create(dst->datatype, + 1.0, 0.0, + 0, 0, dst->caps); + VGint i; + VGfloat start_coords[8]; + VGfloat end_coords[8]; + VGfloat results[8]; + VGubyte common_data[sizeof(VGfloat)*8]; + struct path_iter_data start_iter, end_iter; + + memset(&start_iter, 0, sizeof(struct path_iter_data)); + memset(&end_iter, 0, sizeof(struct path_iter_data)); + + start_iter.path = start; + start_iter.coords = start->control_points->data; + end_iter.path = end; + end_iter.coords = end->control_points->data; + + for (i = 0; i < start->num_segments; ++i) { + VGubyte segment; + VGubyte ssegment, esegment; + VGint snum_coords, enum_coords; + start_iter.segment = ((VGubyte*)(start->segments->data))[i]; + end_iter.segment = ((VGubyte*)(end->segments->data))[i]; + + ssegment = normalize_coords(&start_iter, &snum_coords, + start_coords); + esegment = normalize_coords(&end_iter, &enum_coords, + end_coords); + + if (is_segment_arc(ssegment)) { + if (!is_segment_arc(esegment)) { + path_destroy(res_path); + return VG_FALSE; + } + if (amount > 0.5) + segment = esegment; + else + segment = ssegment; + } else if (is_segment_arc(esegment)) { + path_destroy(res_path); + return VG_FALSE; + } + else if (ssegment != esegment) { + path_destroy(res_path); + return VG_FALSE; + } + else + segment = ssegment; + + linearly_interpolate(results, start_coords, end_coords, + amount, snum_coords); + vg_float_to_datatype(dst->datatype, common_data, results, snum_coords); + path_append_data(res_path, 1, &segment, common_data); + } + + path_append_path(dst, res_path); + path_destroy(res_path); + + dst->dirty = VG_TRUE; + dst->dirty_stroke = VG_TRUE; + + return VG_TRUE; +} + +void path_clear(struct path *p, VGbitfield capabilities) +{ + path_set_capabilities(p, capabilities); + array_destroy(p->segments); + array_destroy(p->control_points); + p->segments = array_create(size_for_datatype(VG_PATH_DATATYPE_S_8)); + p->control_points = array_create(size_for_datatype(p->datatype)); + p->num_segments = 0; + p->dirty = VG_TRUE; + p->dirty_stroke = VG_TRUE; +} + +struct path * path_create_stroke(struct path *p, + struct matrix *matrix) +{ + VGint i; + VGfloat sx, sy, px, py, ox, oy; + VGfloat x0, y0, x1, y1, x2, y2, x3, y3; + VGfloat data[8]; + void *coords = (VGfloat *)p->control_points->data; + int dashed = (p->base.ctx->state.vg.stroke.dash_pattern_num ? 1 : 0); + struct dash_stroker stroker; + struct vg_state *vg_state = &p->base.ctx->state.vg; + + if (p->stroked.path) + { + /* ### compare the dash patterns to see if we can cache them. + * for now we simply always bail out if the path is dashed. + */ + if (memcmp( &p->stroked.matrix, + matrix, + sizeof *matrix ) == 0 && + !dashed && !p->dirty_stroke && + floatsEqual(p->stroked.stroke_width, vg_state->stroke.line_width.f) && + floatsEqual(p->stroked.miter_limit, vg_state->stroke.miter_limit.f) && + p->stroked.cap_style == vg_state->stroke.cap_style && + p->stroked.join_style == vg_state->stroke.join_style) + { + return p->stroked.path; + } + else { + path_destroy( p->stroked.path ); + p->stroked.path = NULL; + } + } + + + sx = sy = px = py = ox = oy = 0.f; + + if (dashed) + dash_stroker_init((struct stroker *)&stroker, vg_state); + else + stroker_init((struct stroker *)&stroker, vg_state); + + stroker_begin((struct stroker *)&stroker); + + for (i = 0; i < p->num_segments; ++i) { + VGubyte segment = ((VGubyte*)(p->segments->data))[i]; + VGint command = SEGMENT_COMMAND(segment); + VGboolean relative = SEGMENT_ABS_REL(segment); + + switch(command) { + case VG_CLOSE_PATH: { + VGfloat x0 = sx; + VGfloat y0 = sy; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_line_to((struct stroker *)&stroker, x0, y0); + } + break; + case VG_MOVE_TO: + data_at(&coords, p, 0, 2, data); + x0 = data[0]; + y0 = data[1]; + map_if_relative(ox, oy, relative, &x0, &y0); + sx = x0; + sy = y0; + ox = x0; + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_move_to((struct stroker *)&stroker, x0, y0); + break; + case VG_LINE_TO: + data_at(&coords, p, 0, 2, data); + x0 = data[0]; + y0 = data[1]; + map_if_relative(ox, oy, relative, &x0, &y0); + ox = x0; + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_line_to((struct stroker *)&stroker, x0, y0); + break; + case VG_HLINE_TO: + data_at(&coords, p, 0, 1, data); + x0 = data[0]; + y0 = oy; + map_if_relative(ox, oy, relative, &x0, 0); + ox = x0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_line_to((struct stroker *)&stroker, x0, y0); + break; + case VG_VLINE_TO: + data_at(&coords, p, 0, 1, data); + x0 = ox; + y0 = data[0]; + map_if_relative(ox, oy, relative, 0, &y0); + oy = y0; + px = x0; + py = y0; + matrix_map_point(matrix, x0, y0, &x0, &y0); + stroker_line_to((struct stroker *)&stroker, x0, y0); + break; + case VG_CUBIC_TO: { + data_at(&coords, p, 0, 6, data); + x0 = ox; + y0 = oy; + x1 = data[0]; + y1 = data[1]; + x2 = data[2]; + y2 = data[3]; + x3 = data[4]; + y3 = data[5]; + map_if_relative(ox, oy, relative, &x1, &y1); + map_if_relative(ox, oy, relative, &x2, &y2); + map_if_relative(ox, oy, relative, &x3, &y3); + if (floatsEqual(x1, ox) && floatsEqual(y1, oy) && + floatsEqual(x1, x2) && floatsEqual(y1, y2) && + floatsEqual(x2, x3) && floatsEqual(y2, y3)) { + /*ignore the empty segment */ + continue; + } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) { + /* if dup vertex, emit a line */ + ox = x3; + oy = y3; + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_line_to((struct stroker *)&stroker, x3, y3); + continue; + } + ox = x3; + oy = y3; + px = x2; + py = y2; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3); + } + break; + case VG_QUAD_TO: { + data_at(&coords, p, 0, 4, data); + x0 = ox; + y0 = oy; + x1 = data[0]; + y1 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(ox, oy, relative, &x1, &y1); + map_if_relative(ox, oy, relative, &x3, &y3); + px = x1; + py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + if (floatsEqual(x1, ox) && floatsEqual(y1, oy) && + floatsEqual(x1, x2) && floatsEqual(y1, y2) && + floatsEqual(x2, x3) && floatsEqual(y2, y3)) { + /*ignore the empty segment */ + continue; + } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) { + /* if dup vertex, emit a line */ + ox = x3; + oy = y3; + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_line_to((struct stroker *)&stroker, x3, y3); + continue; + } + ox = x3; + oy = y3; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3); + } + break; + case VG_SQUAD_TO: { + data_at(&coords, p, 0, 2, data); + x0 = ox; + y0 = oy; + x1 = 2*ox-px; + y1 = 2*oy-py; + x3 = data[0]; + y3 = data[1]; + map_if_relative(ox, oy, relative, &x3, &y3); + px = x1; + py = y1; + { /* form a cubic out of it */ + x2 = (x3 + 2*x1) / 3.f; + y2 = (y3 + 2*y1) / 3.f; + x1 = (x0 + 2*x1) / 3.f; + y1 = (y0 + 2*y1) / 3.f; + } + if (floatsEqual(x1, ox) && floatsEqual(y1, oy) && + floatsEqual(x1, x2) && floatsEqual(y1, y2) && + floatsEqual(x2, x3) && floatsEqual(y2, y3)) { + /*ignore the empty segment */ + continue; + } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) { + /* if dup vertex, emit a line */ + ox = x3; + oy = y3; + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_line_to((struct stroker *)&stroker, x3, y3); + continue; + } + ox = x3; + oy = y3; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3); + } + break; + case VG_SCUBIC_TO: { + data_at(&coords, p, 0, 4, data); + x0 = ox; + y0 = oy; + x1 = 2*ox-px; + y1 = 2*oy-py; + x2 = data[0]; + y2 = data[1]; + x3 = data[2]; + y3 = data[3]; + map_if_relative(ox, oy, relative, &x2, &y2); + map_if_relative(ox, oy, relative, &x3, &y3); + if (floatsEqual(x1, ox) && floatsEqual(y1, oy) && + floatsEqual(x1, x2) && floatsEqual(y1, y2) && + floatsEqual(x2, x3) && floatsEqual(y2, y3)) { + /*ignore the empty segment */ + continue; + } else if (floatsEqual(x3, ox) && floatsEqual(y3, oy)) { + /* if dup vertex, emit a line */ + ox = x3; + oy = y3; + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_line_to((struct stroker *)&stroker, x3, y3); + continue; + } + ox = x3; + oy = y3; + px = x2; + py = y2; + assert(matrix_is_affine(matrix)); + matrix_map_point(matrix, x0, y0, &x0, &y0); + matrix_map_point(matrix, x1, y1, &x1, &y1); + matrix_map_point(matrix, x2, y2, &x2, &y2); + matrix_map_point(matrix, x3, y3, &x3, &y3); + stroker_curve_to((struct stroker *)&stroker, x1, y1, x2, y2, x3, y3); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + VGfloat rh, rv, rot; + struct arc arc; + + data_at(&coords, p, 0, 5, data); + x0 = ox; + y0 = oy; + rh = data[0]; + rv = data[1]; + rot = data[2]; + x1 = data[3]; + y1 = data[4]; + map_if_relative(ox, oy, relative, &x1, &y1); + if (floatsEqual(x1, ox) && floatsEqual(y1, oy)) { + /* if dup vertex, emit a line */ + ox = x1; + oy = y1; + matrix_map_point(matrix, x1, y1, &x1, &y1); + stroker_line_to((struct stroker *)&stroker, x1, y1); + continue; + } + arc_init(&arc, command, x0, y0, x1, y1, + rh, rv, rot); + arc_stroke_cb(&arc, (struct stroker *)&stroker, + matrix); + ox = x1; + oy = y1; + px = x1; + py = y1; + } + break; + default: + abort(); + assert(!"Unknown segment!"); + } + } + + stroker_end((struct stroker *)&stroker); + + if (dashed) + dash_stroker_cleanup((struct dash_stroker *)&stroker); + else + stroker_cleanup((struct stroker *)&stroker); + + p->stroked.path = stroker.base.path; + p->stroked.matrix = *matrix; + p->dirty_stroke = VG_FALSE; + p->stroked.stroke_width = vg_state->stroke.line_width.f; + p->stroked.miter_limit = vg_state->stroke.miter_limit.f; + p->stroked.cap_style = vg_state->stroke.cap_style; + p->stroked.join_style = vg_state->stroke.join_style; + + return stroker.base.path; +} + +void path_render(struct path *p, VGbitfield paintModes) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat = &ctx->state.vg.path_user_to_surface_matrix; + + vg_validate_state(ctx); + + shader_set_drawing_image(ctx->shader, VG_FALSE); + shader_set_image(ctx->shader, 0); +#if 0 + fprintf(stderr, "Matrix(11=%f 12=%f 13=%f 21=%f 22=%f 23=%f 31=%f 32=%f 33=%f)\n", + mat->m[0], mat->m[1], mat->m[2], + mat->m[3], mat->m[4], mat->m[5], + mat->m[6], mat->m[7], mat->m[8]); +#endif + if (paintModes & VG_FILL_PATH) { + /* First the fill */ + shader_set_paint(ctx->shader, ctx->state.vg.fill_paint); + shader_bind(ctx->shader); + path_fill(p, mat); + } + + if (paintModes & VG_STROKE_PATH){ + /* 8.7.5: "line width less than or equal to 0 prevents stroking from + * taking place."*/ + if (ctx->state.vg.stroke.line_width.f <= 0) + return; + shader_set_paint(ctx->shader, ctx->state.vg.stroke_paint); + shader_bind(ctx->shader); + path_stroke(p); + } +} + +void path_fill(struct path *p, struct matrix *mat) +{ + struct vg_context *ctx = vg_current_context(); + { + struct polygon_array *polygon_array = path_get_fill_polygons(p, mat); + struct array *polys = polygon_array->array; + + if (!polygon_array || !polys || !polys->num_elements) { + return; + } + polygon_array_fill(polygon_array, ctx); + } +} + +void path_stroke(struct path *p) +{ + struct vg_context *ctx = vg_current_context(); + struct matrix *mat = &ctx->state.vg.path_user_to_surface_matrix; + VGFillRule old_fill = ctx->state.vg.fill_rule; + struct matrix identity; + struct path *stroke; + + matrix_load_identity(&identity); + stroke = path_create_stroke(p, &identity); + if (stroke && !path_is_empty(stroke)) { + ctx->state.vg.fill_rule = VG_NON_ZERO; + + path_fill(stroke, mat); + + ctx->state.vg.fill_rule = old_fill; + } +} + +void path_move_to(struct path *p, float x, float y) +{ + VGubyte segment = VG_MOVE_TO_ABS; + VGubyte common_data[sizeof(VGfloat) * 2]; + VGfloat data[2] = {x, y}; + + vg_float_to_datatype(p->datatype, common_data, data, 2); + path_append_data(p, 1, &segment, common_data); +} + +void path_line_to(struct path *p, float x, float y) +{ + VGubyte segment = VG_LINE_TO_ABS; + VGubyte common_data[sizeof(VGfloat) * 2]; + VGfloat data[2] = {x, y}; + + vg_float_to_datatype(p->datatype, common_data, data, 2); + + path_append_data(p, 1, &segment, common_data); +} + +void path_cubic_to(struct path *p, float px1, float py1, + float px2, float py2, + float x, float y) +{ + VGubyte segment = VG_CUBIC_TO_ABS; + VGubyte common_data[sizeof(VGfloat) * 6]; + VGfloat data[6]; + + data[0] = px1; data[1] = py1; + data[2] = px2; data[3] = py2; + data[4] = x; data[5] = y; + + vg_float_to_datatype(p->datatype, common_data, data, 6); + + path_append_data(p, 1, &segment, common_data); +} + +static INLINE void line_bounds(VGfloat *line /*x1,y1,x2,y2*/, + VGfloat *bounds) +{ + bounds[0] = MIN2(line[0], line[2]); + bounds[1] = MIN2(line[1], line[3]); + bounds[2] = MAX2(line[0], line[2]) - bounds[0]; + bounds[3] = MAX2(line[1], line[3]) - bounds[1]; +} + +static INLINE void unite_bounds(VGfloat *bounds, + VGfloat *el) +{ + VGfloat cx1, cy1, cx2, cy2; + VGfloat nx1, ny1, nx2, ny2; + + cx1 = bounds[0]; + cy1 = bounds[1]; + cx2 = bounds[0] + bounds[2]; + cy2 = bounds[1] + bounds[3]; + + nx1 = el[0]; + ny1 = el[1]; + nx2 = el[0] + el[2]; + ny2 = el[1] + el[3]; + + bounds[0] = MIN2(cx1, nx1); + bounds[1] = MIN2(cy1, ny1); + bounds[2] = MAX2(cx2, nx2) - bounds[0]; + bounds[3] = MAX2(cy2, ny2) - bounds[1]; +} + +static INLINE void set_bounds(VGfloat *bounds, + VGfloat *element_bounds, + VGboolean *initialized) +{ + if (!(*initialized)) { + memcpy(bounds, element_bounds, 4 * sizeof(VGfloat)); + *initialized = VG_TRUE; + } else + unite_bounds(bounds, element_bounds); +} + +void path_bounding_rect(struct path *p, float *x, float *y, + float *w, float *h) +{ + VGint i; + VGfloat coords[8]; + struct path_iter_data iter; + VGint num_coords; + VGfloat bounds[4]; + VGfloat element_bounds[4]; + VGfloat ox, oy; + VGboolean bounds_inited = VG_FALSE; + + memset(&iter, 0, sizeof(struct path_iter_data)); + memset(&bounds, 0, sizeof(bounds)); + + if (!p->num_segments) { + bounds[2] = -1; + bounds[3] = -1; + } + + + iter.path = p; + iter.coords = p->control_points->data; + + for (i = 0; i < p->num_segments; ++i) { + VGubyte segment; + iter.segment = ((VGubyte*)(p->segments->data))[i]; + + ox = iter.ox; + oy = iter.oy; + + segment = normalize_coords(&iter, &num_coords, coords); + + switch(segment) { + case VG_CLOSE_PATH: + case VG_MOVE_TO_ABS: + break; + case VG_LINE_TO_ABS: { + VGfloat line[4] = {ox, oy, coords[0], coords[1]}; + line_bounds(line, element_bounds); + set_bounds(bounds, element_bounds, &bounds_inited); + } + break; + case VG_CUBIC_TO_ABS: { + struct bezier bezier; + bezier_init(&bezier, ox, oy, + coords[0], coords[1], + coords[2], coords[3], + coords[4], coords[5]); + bezier_exact_bounds(&bezier, element_bounds); + set_bounds(bounds, element_bounds, &bounds_inited); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct matrix identity; + struct path *path = path_create(VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + + matrix_load_identity(&identity); + arc_init(&arc, segment, + ox, oy, coords[3], coords[4], + coords[0], coords[1], coords[2]); + + arc_to_path(&arc, path, &identity); + + path_bounding_rect(path, element_bounds + 0, element_bounds + 1, + element_bounds + 2, element_bounds + 3); + set_bounds(bounds, element_bounds, &bounds_inited); + } + break; + default: + assert(0); + } + } + + *x = bounds[0]; + *y = bounds[1]; + *w = bounds[2]; + *h = bounds[3]; +} + +float path_length(struct path *p, int start_segment, int num_segments) +{ + VGint i; + VGfloat coords[8]; + struct path_iter_data iter; + VGint num_coords; + VGfloat length = 0; + VGfloat ox, oy; + VGboolean in_range = VG_FALSE; + + memset(&iter, 0, sizeof(struct path_iter_data)); + + iter.path = p; + iter.coords = p->control_points->data; + + for (i = 0; i < (start_segment + num_segments); ++i) { + VGubyte segment; + + iter.segment = ((VGubyte*)(p->segments->data))[i]; + + ox = iter.ox; + oy = iter.oy; + + segment = normalize_coords(&iter, &num_coords, coords); + + in_range = (i >= start_segment) && i <= (start_segment + num_segments); + if (!in_range) + continue; + + switch(segment) { + case VG_MOVE_TO_ABS: + break; + case VG_CLOSE_PATH: { + VGfloat line[4] = {ox, oy, iter.sx, iter.sy}; + length += line_lengthv(line); + } + break; + case VG_LINE_TO_ABS: { + VGfloat line[4] = {ox, oy, coords[0], coords[1]}; + length += line_lengthv(line); + } + break; + case VG_CUBIC_TO_ABS: { + struct bezier bezier; + bezier_init(&bezier, ox, oy, + coords[0], coords[1], + coords[2], coords[3], + coords[4], coords[5]); + length += bezier_length(&bezier, BEZIER_DEFAULT_ERROR); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct matrix identity; + struct path *path = path_create(VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + + matrix_load_identity(&identity); + arc_init(&arc, segment, + ox, oy, coords[3], coords[4], + coords[0], coords[1], coords[2]); + + arc_to_path(&arc, path, &identity); + + length += path_length(path, 0, path_num_segments(path)); + } + break; + default: + assert(0); + } + } + + return length; +} + +static INLINE VGboolean point_on_current_segment(VGfloat distance, + VGfloat length, + VGfloat segment_length) +{ + return + (((floatIsZero(distance) || distance < 0) && floatIsZero(length)) || + ((distance > length || floatsEqual(distance, length)) && + (floatsEqual(distance, length + segment_length) || + distance < (length + segment_length)))); +} + +static VGboolean path_point_segment(struct path_iter_data iter, + struct path_iter_data prev_iter, + VGfloat coords[8], + VGfloat distance, + VGfloat length, VGfloat *current_length, + VGfloat *point, VGfloat *normal) +{ + switch (iter.segment) { + case VG_MOVE_TO_ABS: + break; + case VG_CLOSE_PATH: { + VGfloat line[4] = {prev_iter.ox, prev_iter.oy, iter.sx, iter.sy}; + VGboolean on_current_segment = VG_FALSE; + *current_length = line_lengthv(line); + on_current_segment = point_on_current_segment(distance, + length, + *current_length); + if (on_current_segment) { + VGfloat at = (distance - length) / line_lengthv(line); + line_normal_vector(line, normal); + line_point_at(line, at, point); + return VG_TRUE; + } + } + break; + case VG_LINE_TO_ABS: { + VGfloat line[4] = {prev_iter.ox, prev_iter.oy, coords[0], coords[1]}; + VGboolean on_current_segment = VG_FALSE; + *current_length = line_lengthv(line); + on_current_segment = point_on_current_segment(distance, + length, + *current_length); + if (on_current_segment) { + VGfloat at = (distance - length) / line_lengthv(line); + line_normal_vector(line, normal); + line_point_at(line, at, point); + return VG_TRUE; + } + } + break; + case VG_CUBIC_TO_ABS: { + struct bezier bezier; + bezier_init(&bezier, prev_iter.ox, prev_iter.oy, + coords[0], coords[1], + coords[2], coords[3], + coords[4], coords[5]); + *current_length = bezier_length(&bezier, BEZIER_DEFAULT_ERROR); + if (point_on_current_segment(distance, length, *current_length)) { + bezier_point_at_length(&bezier, distance - length, + point, normal); + return VG_TRUE; + } + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct matrix identity; + struct path *path = path_create(VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + + matrix_load_identity(&identity); + arc_init(&arc, iter.segment, + prev_iter.ox, prev_iter.oy, coords[3], coords[4], + coords[0], coords[1], coords[2]); + + arc_to_path(&arc, path, &identity); + + *current_length = path_length(path, 0, path_num_segments(path)); + if (point_on_current_segment(distance, length, *current_length)) { + path_point(path, 0, path_num_segments(path), + distance - length, point, normal); + return VG_TRUE; + } + } + break; + default: + assert(0); + } + return VG_FALSE; +} + +void path_point(struct path *p, VGint start_segment, VGint num_segments, + VGfloat distance, VGfloat *point, VGfloat *normal) +{ + VGint i; + VGfloat coords[8]; + struct path_iter_data iter, prev_iter; + VGint num_coords; + VGfloat length = 0; + VGfloat current_length = 0; + + memset(&iter, 0, sizeof(struct path_iter_data)); + memset(&prev_iter, 0, sizeof(struct path_iter_data)); + + point[0] = 0; + point[1] = 0; + + normal[0] = 0; + normal[1] = -1; + + iter.path = p; + iter.coords = p->control_points->data; + if (distance < 0) + distance = 0; + + for (i = 0; i < (start_segment + num_segments); ++i) { + VGboolean outside_range = (i < start_segment || + i >= (start_segment + num_segments)); + + prev_iter = iter; + + iter.segment = ((VGubyte*)(p->segments->data))[i]; + iter.segment = normalize_coords(&iter, &num_coords, coords); + + if (outside_range) + continue; + + if (path_point_segment(iter, prev_iter, coords, + distance, length, ¤t_length, + point, normal)) + return; + + length += current_length; + } + + /* + *OpenVG 1.0 - 8.6.11 vgPointAlongPath + * + * If distance is greater than or equal to the path length + *(i.e., the value returned by vgPathLength when called with the same + *startSegment and numSegments parameters), the visual ending point of + *the path is used. + */ + { + switch (iter.segment) { + case VG_MOVE_TO_ABS: + break; + case VG_CLOSE_PATH: { + VGfloat line[4] = {prev_iter.ox, prev_iter.oy, iter.sx, iter.sy}; + line_normal_vector(line, normal); + line_point_at(line, 1.f, point); + } + break; + case VG_LINE_TO_ABS: { + VGfloat line[4] = {prev_iter.ox, prev_iter.oy, coords[0], coords[1]}; + line_normal_vector(line, normal); + line_point_at(line, 1.f, point); + } + break; + case VG_CUBIC_TO_ABS: { + struct bezier bezier; + bezier_init(&bezier, prev_iter.ox, prev_iter.oy, + coords[0], coords[1], + coords[2], coords[3], + coords[4], coords[5]); + bezier_point_at_t(&bezier, 1.f, point, normal); + } + break; + case VG_SCCWARC_TO: + case VG_SCWARC_TO: + case VG_LCCWARC_TO: + case VG_LCWARC_TO: { + struct arc arc; + struct matrix identity; + struct path *path = path_create(VG_PATH_DATATYPE_F, + 1, 0, 0, 0, VG_PATH_CAPABILITY_ALL); + + matrix_load_identity(&identity); + arc_init(&arc, iter.segment, + prev_iter.ox, prev_iter.oy, coords[3], coords[4], + coords[0], coords[1], coords[2]); + + arc_to_path(&arc, path, &identity); + + path_point(path, 0, path_num_segments(path), + /* to make sure we're bigger than len * 2 it */ + 2 * path_length(path, 0, path_num_segments(path)), + point, normal); + } + break; + default: + assert(0); + } + } +} + +VGboolean path_is_empty(struct path *p) +{ + return p->segments->num_elements == 0; +} diff --git a/src/gallium/state_trackers/vega/path.h b/src/gallium/state_trackers/vega/path.h new file mode 100644 index 0000000000..e34538b736 --- /dev/null +++ b/src/gallium/state_trackers/vega/path.h @@ -0,0 +1,126 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef _PATH_H +#define _PATH_H + +#include "VG/openvg.h" + +struct path; +struct polygon; +struct matrix; + +enum fill_rule { + ODD_EVEN_FILL, + WINDING_FILL +}; + + +struct path_for_each_data { + VGubyte segment; + /* all coords are absolute, even if segment is relative */ + const VGfloat *coords; + VGfloat sx, sy, ox, oy, px, py; + void *user_data; +}; + +typedef VGboolean (*path_for_each_cb)(struct path *p, + struct path_for_each_data *data); + + +struct path *path_create(VGPathDatatype dt, VGfloat scale, VGfloat bias, + VGint segmentCapacityHint, + VGint coordCapacityHint, + VGbitfield capabilities); +void path_destroy(struct path *p); + +VGbitfield path_capabilities(struct path *p); +void path_set_capabilities(struct path *p, VGbitfield bf); + +void path_append_data(struct path *p, + VGint numSegments, + const VGubyte * pathSegments, + const void * pathData); + +void path_append_path(struct path *dst, + struct path *src); + +VGint path_num_segments(struct path *p); + +void path_bounding_rect(struct path *p, float *x, float *y, + float *w, float *h); +float path_length(struct path *p, int start_segment, int num_segments); + +void path_set_fill_rule(enum fill_rule fill); +enum fill_rule path_fill_rule(enum fill_rule fill); + +VGboolean path_is_empty(struct path *p); + +VGbyte path_datatype_size(struct path *p); + +VGPathDatatype path_datatype(struct path *p); +VGfloat path_scale(struct path *p); +VGfloat path_bias(struct path *p); +VGint path_num_coords(struct path *p); + +void path_modify_coords(struct path *p, + VGint startIndex, + VGint numSegments, + const void * pathData); + +struct path *path_create_stroke(struct path *p, + struct matrix *m); + +void path_for_each_segment(struct path *path, + path_for_each_cb cb, + void *user_data); + +void path_transform(struct path *dst, struct path *src); +VGboolean path_interpolate(struct path *dst, + struct path *start, struct path *end, + VGfloat amount); + +void path_clear(struct path *p, VGbitfield capabilities); +void path_render(struct path *p, VGbitfield paintModes); +void path_fill(struct path *p, struct matrix *mat); +void path_stroke(struct path *p); + +void path_move_to(struct path *p, float x, float y); +void path_line_to(struct path *p, float x, float y); +void path_cubic_to(struct path *p, float px1, float py1, + float px2, float py2, + float x, float y); + +void path_point(struct path *p, VGint startSegment, VGint numSegments, + VGfloat distance, VGfloat *point, VGfloat *normal); + + + +void vg_float_to_datatype(VGPathDatatype datatype, + VGubyte *common_data, + const VGfloat *data, + VGint num_coords); +#endif diff --git a/src/gallium/state_trackers/vega/path_utils.h b/src/gallium/state_trackers/vega/path_utils.h new file mode 100644 index 0000000000..c2b3221dc5 --- /dev/null +++ b/src/gallium/state_trackers/vega/path_utils.h @@ -0,0 +1,109 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef PATH_UTILS_H +#define PATH_UTILS_H + +#include "VG/openvg.h" + +#define SEGMENT_COMMAND(command) /* Extract segment type */ \ + ((command) & 0x1e) +#define SEGMENT_ABS_REL(command) /* Extract absolute/relative bit */ \ + ((command) & 0x1) + +static INLINE VGint size_for_datatype(VGPathDatatype datatype) +{ + switch(datatype) { + case VG_PATH_DATATYPE_S_8: + return 1; + case VG_PATH_DATATYPE_S_16: + return 2; + case VG_PATH_DATATYPE_S_32: + return 4; + case VG_PATH_DATATYPE_F: + return 4; + default: + assert(!"unknown datatype"); + } + return 0; +} + +static INLINE VGint num_elements_for_segments(const VGubyte *segments, + VGint num_segments) +{ + VGint i; + VGint count = 0; + + for (i = 0; i < num_segments; ++i) { + VGubyte segment = segments[i]; + VGint command = SEGMENT_COMMAND(segment); + switch(command) { + case VG_CLOSE_PATH: + break; + case VG_MOVE_TO: + count += 2; + break; + case VG_LINE_TO: + count += 2; + break; + case VG_HLINE_TO: + count += 1; + break; + case VG_VLINE_TO: + count += 1; + break; + case VG_QUAD_TO: + count += 4; + break; + case VG_CUBIC_TO: + count += 6; + break; + case VG_SQUAD_TO: + count += 2; + break; + case VG_SCUBIC_TO: + count += 4; + break; + case VG_SCCWARC_TO: + count += 5; + break; + case VG_SCWARC_TO: + count += 5; + break; + case VG_LCCWARC_TO: + count += 5; + break; + case VG_LCWARC_TO: + count += 5; + break; + default: + assert(!"Unknown segment!"); + } + } + return count; +} + +#endif diff --git a/src/gallium/state_trackers/vega/polygon.c b/src/gallium/state_trackers/vega/polygon.c new file mode 100644 index 0000000000..b6d282d803 --- /dev/null +++ b/src/gallium/state_trackers/vega/polygon.c @@ -0,0 +1,550 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "polygon.h" + +#include "matrix.h" /*for floatsEqual*/ +#include "vg_context.h" +#include "vg_state.h" +#include "paint.h" +#include "renderer.h" +#include "util_array.h" +#include "VG/openvg.h" + +#include "pipe/p_context.h" +#include "pipe/p_defines.h" +#include "pipe/p_state.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" + +#include "util/u_draw_quad.h" +#include "util/u_math.h" + +#include <string.h> +#include <stdlib.h> + +#define DEBUG_POLYGON 0 + +#define COMPONENTS 2 + +struct polygon +{ + VGfloat *data; + VGint size; + + VGint num_verts; + + VGboolean dirty; + struct pipe_buffer *vbuf; + struct pipe_screen *screen; +}; + +static float *ptr_to_vertex(float *data, int idx) +{ + return data + (idx * COMPONENTS); +} + +#if 0 +static void polygon_print(struct polygon *poly) +{ + int i; + float *vert; + debug_printf("Polygon %p, size = %d\n", poly, poly->num_verts); + for (i = 0; i < poly->num_verts; ++i) { + vert = ptr_to_vertex(poly->data, i); + debug_printf("%f, %f, ", vert[0], vert[1]); + } + debug_printf("\nend\n"); +} +#endif + + +struct polygon * polygon_create(int size) +{ + struct polygon *poly = (struct polygon*)malloc(sizeof(struct polygon)); + + poly->data = malloc(sizeof(float) * COMPONENTS * size); + poly->size = size; + poly->num_verts = 0; + poly->dirty = VG_TRUE; + poly->vbuf = NULL; + + return poly; +} + +struct polygon * polygon_create_from_data(float *data, int size) +{ + struct polygon *poly = polygon_create(size); + + memcpy(poly->data, data, sizeof(float) * COMPONENTS * size); + poly->num_verts = size; + poly->dirty = VG_TRUE; + poly->vbuf = NULL; + + return poly; +} + +void polygon_destroy(struct polygon *poly) +{ + if (poly->vbuf) + pipe_buffer_reference(&poly->vbuf, NULL); + + free(poly->data); + free(poly); +} + +void polygon_resize(struct polygon *poly, int new_size) +{ + float *data = (float*)malloc(sizeof(float) * COMPONENTS * new_size); + int size = MIN2(sizeof(float) * COMPONENTS * new_size, + sizeof(float) * COMPONENTS * poly->size); + memcpy(data, poly->data, size); + free(poly->data); + poly->data = data; + poly->size = new_size; + poly->dirty = VG_TRUE; +} + +int polygon_size(struct polygon *poly) +{ + return poly->size; +} + +int polygon_vertex_count(struct polygon *poly) +{ + return poly->num_verts; +} + +float * polygon_data(struct polygon *poly) +{ + return poly->data; +} + +void polygon_vertex_append(struct polygon *p, + float x, float y) +{ + float *vert; +#if DEBUG_POLYGON + debug_printf("Append vertex [%f, %f]\n", x, y); +#endif + if (p->num_verts >= p->size) { + polygon_resize(p, p->size * 2); + } + + vert = ptr_to_vertex(p->data, p->num_verts); + vert[0] = x; + vert[1] = y; + ++p->num_verts; + p->dirty = VG_TRUE; +} + +void polygon_set_vertex(struct polygon *p, int idx, + float x, float y) +{ + float *vert; + if (idx >= p->num_verts) { + /*fixme: error reporting*/ + abort(); + return; + } + + vert = ptr_to_vertex(p->data, idx); + vert[0] = x; + vert[1] = y; + p->dirty = VG_TRUE; +} + +void polygon_vertex(struct polygon *p, int idx, + float *vertex) +{ + float *vert; + if (idx >= p->num_verts) { + /*fixme: error reporting*/ + abort(); + return; + } + + vert = ptr_to_vertex(p->data, idx); + vertex[0] = vert[0]; + vertex[1] = vert[1]; +} + +void polygon_bounding_rect(struct polygon *p, + float *rect) +{ + int i; + float minx, miny, maxx, maxy; + float *vert = ptr_to_vertex(p->data, 0); + minx = vert[0]; + maxx = vert[0]; + miny = vert[1]; + maxy = vert[1]; + + for (i = 1; i < p->num_verts; ++i) { + vert = ptr_to_vertex(p->data, i); + minx = MIN2(vert[0], minx); + miny = MIN2(vert[1], miny); + + maxx = MAX2(vert[0], maxx); + maxy = MAX2(vert[1], maxy); + } + + rect[0] = minx; + rect[1] = miny; + rect[2] = maxx - minx; + rect[3] = maxy - miny; +} + +int polygon_contains_point(struct polygon *p, + float x, float y) +{ + return 0; +} + +void polygon_append_polygon(struct polygon *dst, + struct polygon *src) +{ + if (dst->num_verts + src->num_verts >= dst->size) { + polygon_resize(dst, dst->num_verts + src->num_verts * 1.5); + } + memcpy(ptr_to_vertex(dst->data, dst->num_verts), + src->data, src->num_verts * COMPONENTS * sizeof(VGfloat)); + dst->num_verts += src->num_verts; +} + +VGboolean polygon_is_closed(struct polygon *p) +{ + VGfloat start[2], end[2]; + + polygon_vertex(p, 0, start); + polygon_vertex(p, p->num_verts - 1, end); + + return floatsEqual(start[0], end[0]) && floatsEqual(start[1], end[1]); +} + +static void set_blend_for_fill(struct pipe_blend_state *blend) +{ + memset(blend, 0, sizeof(struct pipe_blend_state)); + blend->colormask = 0; /*disable colorwrites*/ + + blend->rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA; +} + +static void draw_polygon(struct vg_context *ctx, + struct polygon *poly) +{ + int vert_size; + struct pipe_context *pipe; + struct pipe_vertex_buffer vbuffer; + struct pipe_vertex_element velement; + + vert_size = poly->num_verts * COMPONENTS * sizeof(float); + + /*polygon_print(poly);*/ + + pipe = ctx->pipe; + + if (poly->vbuf == NULL || poly->dirty) { + if (poly->vbuf) { + pipe_buffer_reference(&poly->vbuf, + NULL); + } + poly->screen = pipe->screen; + poly->vbuf= pipe_user_buffer_create(poly->screen, + poly->data, + vert_size); + poly->dirty = VG_FALSE; + } + + + /* tell pipe about the vertex buffer */ + memset(&vbuffer, 0, sizeof(vbuffer)); + vbuffer.buffer = poly->vbuf; + vbuffer.stride = COMPONENTS * sizeof(float); /* vertex size */ + vbuffer.buffer_offset = 0; + vbuffer.max_index = poly->num_verts - 1; + pipe->set_vertex_buffers(pipe, 1, &vbuffer); + + /* tell pipe about the vertex attributes */ + velement.src_offset = 0; + velement.vertex_buffer_index = 0; + velement.src_format = PIPE_FORMAT_R32G32_FLOAT; + velement.nr_components = COMPONENTS; + pipe->set_vertex_elements(pipe, 1, &velement); + + /* draw */ + pipe->draw_arrays(pipe, PIPE_PRIM_TRIANGLE_FAN, + 0, poly->num_verts); +} + +void polygon_fill(struct polygon *poly, struct vg_context *ctx) +{ + struct pipe_depth_stencil_alpha_state dsa; + struct pipe_blend_state blend; + VGfloat bounds[4]; + VGfloat min_x, min_y, max_x, max_y; + assert(poly); + polygon_bounding_rect(poly, bounds); + min_x = bounds[0]; + min_y = bounds[1]; + max_x = bounds[0] + bounds[2]; + max_y = bounds[1] + bounds[3]; + +#if DEBUG_POLYGON + debug_printf("Poly bounds are [%f, %f], [%f, %f]\n", + min_x, min_y, max_x, max_y); +#endif + + set_blend_for_fill(&blend); + + memset(&dsa, 0, sizeof(struct pipe_depth_stencil_alpha_state)); + + cso_save_blend(ctx->cso_context); + cso_save_depth_stencil_alpha(ctx->cso_context); + + dsa.stencil[0].enabled = 1; + if (ctx->state.vg.fill_rule == VG_EVEN_ODD) { + dsa.stencil[0].writemask = 1; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INVERT; + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + draw_polygon(ctx, poly); + } else if (ctx->state.vg.fill_rule == VG_NON_ZERO) { + struct pipe_screen *screen = ctx->pipe->screen; + + if (screen->get_param(screen, PIPE_CAP_TWO_SIDED_STENCIL)) { + /* front */ + dsa.stencil[0].writemask = ~0; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP; + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + /* back */ + dsa.stencil[1].enabled = 1; + dsa.stencil[1].writemask = ~0; + dsa.stencil[1].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[1].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[1].zpass_op = PIPE_STENCIL_OP_DECR_WRAP; + dsa.stencil[1].func = PIPE_FUNC_ALWAYS; + dsa.stencil[1].ref_value = 0; + dsa.stencil[1].valuemask = ~0; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + draw_polygon(ctx, poly); + } else { + struct pipe_rasterizer_state raster; + + memcpy(&raster, &ctx->state.g3d.rasterizer, sizeof(struct pipe_rasterizer_state)); + + cso_save_rasterizer(ctx->cso_context); + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + raster.cull_mode = raster.front_winding ^ PIPE_WINDING_BOTH; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + cso_set_rasterizer(ctx->cso_context, &raster); + draw_polygon(ctx, poly); + + raster.cull_mode = raster.front_winding; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_DECR_WRAP; + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + cso_set_rasterizer(ctx->cso_context, &raster); + draw_polygon(ctx, poly); + + cso_restore_rasterizer(ctx->cso_context); + } + } + + /* restore color writes */ + cso_restore_blend(ctx->cso_context); + /* setup stencil ops */ + dsa.stencil[0].func = PIPE_FUNC_NOTEQUAL; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = dsa.stencil[0].writemask; + dsa.stencil[1].enabled = 0; + memcpy(&dsa.depth, &ctx->state.g3d.dsa.depth, + sizeof(struct pipe_depth_state)); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + + /* render the quad to propagate the rendering from stencil */ + renderer_draw_quad(ctx->renderer, min_x, min_y, + max_x, max_y, 0.0f/*depth should be disabled*/); + + cso_restore_depth_stencil_alpha(ctx->cso_context); +} + +void polygon_array_fill(struct polygon_array *polyarray, struct vg_context *ctx) +{ + struct array *polys = polyarray->array; + struct pipe_depth_stencil_alpha_state dsa; + struct pipe_blend_state blend; + VGfloat min_x = polyarray->min_x; + VGfloat min_y = polyarray->min_y; + VGfloat max_x = polyarray->max_x; + VGfloat max_y = polyarray->max_y; + VGint i; + + +#if DEBUG_POLYGON + debug_printf("%s: Poly bounds are [%f, %f], [%f, %f]\n", + __FUNCTION__, + min_x, min_y, max_x, max_y); +#endif + + set_blend_for_fill(&blend); + + memset(&dsa, 0, sizeof(struct pipe_depth_stencil_alpha_state)); + + cso_save_blend(ctx->cso_context); + cso_save_depth_stencil_alpha(ctx->cso_context); + + dsa.stencil[0].enabled = 1; + if (ctx->state.vg.fill_rule == VG_EVEN_ODD) { + dsa.stencil[0].writemask = 1; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INVERT; + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + for (i = 0; i < polys->num_elements; ++i) { + struct polygon *poly = (((struct polygon**)polys->data)[i]); + draw_polygon(ctx, poly); + } + } else if (ctx->state.vg.fill_rule == VG_NON_ZERO) { + struct pipe_screen *screen = ctx->pipe->screen; + + if (screen->get_param(screen, PIPE_CAP_TWO_SIDED_STENCIL)) { + /* front */ + dsa.stencil[0].writemask = ~0; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP; + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + /* back */ + dsa.stencil[1].enabled = 1; + dsa.stencil[1].writemask = ~0; + dsa.stencil[1].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[1].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[1].zpass_op = PIPE_STENCIL_OP_DECR_WRAP; + dsa.stencil[1].func = PIPE_FUNC_ALWAYS; + dsa.stencil[1].ref_value = 0; + dsa.stencil[1].valuemask = ~0; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + for (i = 0; i < polys->num_elements; ++i) { + struct polygon *poly = (((struct polygon**)polys->data)[i]); + draw_polygon(ctx, poly); + } + } else { + struct pipe_rasterizer_state raster; + + memcpy(&raster, &ctx->state.g3d.rasterizer, sizeof(struct pipe_rasterizer_state)); + + cso_save_rasterizer(ctx->cso_context); + dsa.stencil[0].func = PIPE_FUNC_ALWAYS; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = ~0; + + raster.cull_mode = raster.front_winding ^ PIPE_WINDING_BOTH; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_INCR_WRAP; + + cso_set_blend(ctx->cso_context, &blend); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + cso_set_rasterizer(ctx->cso_context, &raster); + for (i = 0; i < polys->num_elements; ++i) { + struct polygon *poly = (((struct polygon**)polys->data)[i]); + draw_polygon(ctx, poly); + } + + raster.cull_mode = raster.front_winding; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_KEEP; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_DECR_WRAP; + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + cso_set_rasterizer(ctx->cso_context, &raster); + for (i = 0; i < polys->num_elements; ++i) { + struct polygon *poly = (((struct polygon**)polys->data)[i]); + draw_polygon(ctx, poly); + } + + cso_restore_rasterizer(ctx->cso_context); + } + } + + /* restore color writes */ + cso_restore_blend(ctx->cso_context); + /* setup stencil ops */ + dsa.stencil[0].func = PIPE_FUNC_NOTEQUAL; + dsa.stencil[0].fail_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].zfail_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].zpass_op = PIPE_STENCIL_OP_REPLACE; + dsa.stencil[0].ref_value = 0; + dsa.stencil[0].valuemask = dsa.stencil[0].writemask; + dsa.stencil[1].enabled = 0; + memcpy(&dsa.depth, &ctx->state.g3d.dsa.depth, + sizeof(struct pipe_depth_state)); + cso_set_depth_stencil_alpha(ctx->cso_context, &dsa); + + /* render the quad to propagate the rendering from stencil */ + renderer_draw_quad(ctx->renderer, min_x, min_y, + max_x, max_y, 0.0f/*depth should be disabled*/); + + cso_restore_depth_stencil_alpha(ctx->cso_context); +} diff --git a/src/gallium/state_trackers/vega/polygon.h b/src/gallium/state_trackers/vega/polygon.h new file mode 100644 index 0000000000..22672b728e --- /dev/null +++ b/src/gallium/state_trackers/vega/polygon.h @@ -0,0 +1,75 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef POLYGON_H +#define POLYGON_H + +#include "VG/openvg.h" + +struct polygon; +struct vg_context; +struct vg_paint; +struct array; + +struct polygon *polygon_create(int size); +struct polygon *polygon_create_from_data(float *data, int size); +void polygon_destroy(struct polygon *poly); + +void polygon_resize(struct polygon *poly, int new_size); +int polygon_size(struct polygon *poly); + +int polygon_vertex_count(struct polygon *poly); +float * polygon_data(struct polygon *poly); + +void polygon_vertex_append(struct polygon *p, + float x, float y); +void polygon_append_polygon(struct polygon *dst, + struct polygon *src); +void polygon_set_vertex(struct polygon *p, int idx, + float x, float y); +void polygon_vertex(struct polygon *p, int idx, + float *vertex); + +void polygon_bounding_rect(struct polygon *p, + float *rect); +int polygon_contains_point(struct polygon *p, + float x, float y); + +VGboolean polygon_is_closed(struct polygon *p); + +void polygon_fill(struct polygon *p, struct vg_context *pipe); + +/* TODO: make a file/module around this struct + */ +struct polygon_array { + struct array *array; + VGfloat min_x, max_x; + VGfloat min_y, max_y; +}; + +void polygon_array_fill(struct polygon_array *polyarray, struct vg_context *ctx); + +#endif diff --git a/src/gallium/state_trackers/vega/renderer.c b/src/gallium/state_trackers/vega/renderer.c new file mode 100644 index 0000000000..f7c5f2f0cd --- /dev/null +++ b/src/gallium/state_trackers/vega/renderer.c @@ -0,0 +1,592 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "renderer.h" + +#include "vg_context.h" + +#include "pipe/p_context.h" +#include "pipe/p_state.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" +#include "pipe/p_shader_tokens.h" + +#include "util/u_draw_quad.h" +#include "util/u_simple_shaders.h" +#include "util/u_memory.h" + +#include "cso_cache/cso_context.h" + +struct renderer { + struct pipe_context *pipe; + struct vg_context *owner; + + struct cso_context *cso; + + void *fs; + + VGfloat vertices[4][2][4]; +}; + +static void setup_shaders(struct renderer *ctx) +{ + struct pipe_context *pipe = ctx->pipe; + /* fragment shader */ + ctx->fs = util_make_fragment_tex_shader(pipe); +} + +static struct pipe_buffer * +setup_vertex_data(struct renderer *ctx, + float x0, float y0, float x1, float y1, float z) +{ + ctx->vertices[0][0][0] = x0; + ctx->vertices[0][0][1] = y0; + ctx->vertices[0][0][2] = z; + ctx->vertices[0][1][0] = 0.0f; /*s*/ + ctx->vertices[0][1][1] = 0.0f; /*t*/ + + ctx->vertices[1][0][0] = x1; + ctx->vertices[1][0][1] = y0; + ctx->vertices[1][0][2] = z; + ctx->vertices[1][1][0] = 1.0f; /*s*/ + ctx->vertices[1][1][1] = 0.0f; /*t*/ + + ctx->vertices[2][0][0] = x1; + ctx->vertices[2][0][1] = y1; + ctx->vertices[2][0][2] = z; + ctx->vertices[2][1][0] = 1.0f; + ctx->vertices[2][1][1] = 1.0f; + + ctx->vertices[3][0][0] = x0; + ctx->vertices[3][0][1] = y1; + ctx->vertices[3][0][2] = z; + ctx->vertices[3][1][0] = 0.0f; + ctx->vertices[3][1][1] = 1.0f; + + return pipe_user_buffer_create( ctx->pipe->screen, + ctx->vertices, + sizeof(ctx->vertices) ); +} + +static struct pipe_buffer * +setup_vertex_data_tex(struct renderer *ctx, + float x0, float y0, float x1, float y1, + float s0, float t0, float s1, float t1, + float z) +{ + ctx->vertices[0][0][0] = x0; + ctx->vertices[0][0][1] = y0; + ctx->vertices[0][0][2] = z; + ctx->vertices[0][1][0] = s0; /*s*/ + ctx->vertices[0][1][1] = t0; /*t*/ + + ctx->vertices[1][0][0] = x1; + ctx->vertices[1][0][1] = y0; + ctx->vertices[1][0][2] = z; + ctx->vertices[1][1][0] = s1; /*s*/ + ctx->vertices[1][1][1] = t0; /*t*/ + + ctx->vertices[2][0][0] = x1; + ctx->vertices[2][0][1] = y1; + ctx->vertices[2][0][2] = z; + ctx->vertices[2][1][0] = s1; + ctx->vertices[2][1][1] = t1; + + ctx->vertices[3][0][0] = x0; + ctx->vertices[3][0][1] = y1; + ctx->vertices[3][0][2] = z; + ctx->vertices[3][1][0] = s0; + ctx->vertices[3][1][1] = t1; + + return pipe_user_buffer_create( ctx->pipe->screen, + ctx->vertices, + sizeof(ctx->vertices) ); +} + + +static struct pipe_buffer * +setup_vertex_data_qtex(struct renderer *ctx, + float x0, float y0, float x1, float y1, + float x2, float y2, float x3, float y3, + float s0, float t0, float s1, float t1, + float z) +{ + ctx->vertices[0][0][0] = x0; + ctx->vertices[0][0][1] = y0; + ctx->vertices[0][0][2] = z; + ctx->vertices[0][1][0] = s0; /*s*/ + ctx->vertices[0][1][1] = t0; /*t*/ + + ctx->vertices[1][0][0] = x1; + ctx->vertices[1][0][1] = y1; + ctx->vertices[1][0][2] = z; + ctx->vertices[1][1][0] = s1; /*s*/ + ctx->vertices[1][1][1] = t0; /*t*/ + + ctx->vertices[2][0][0] = x2; + ctx->vertices[2][0][1] = y2; + ctx->vertices[2][0][2] = z; + ctx->vertices[2][1][0] = s1; + ctx->vertices[2][1][1] = t1; + + ctx->vertices[3][0][0] = x3; + ctx->vertices[3][0][1] = y3; + ctx->vertices[3][0][2] = z; + ctx->vertices[3][1][0] = s0; + ctx->vertices[3][1][1] = t1; + + return pipe_user_buffer_create( ctx->pipe->screen, + ctx->vertices, + sizeof(ctx->vertices) ); +} + +struct renderer * renderer_create(struct vg_context *owner) +{ + VGint i; + struct renderer *renderer = CALLOC_STRUCT(renderer); + + if (!renderer) + return NULL; + + renderer->owner = owner; + renderer->pipe = owner->pipe; + renderer->cso = owner->cso_context; + + setup_shaders(renderer); + + /* init vertex data that doesn't change */ + for (i = 0; i < 4; i++) { + renderer->vertices[i][0][3] = 1.0f; /* w */ + renderer->vertices[i][1][2] = 0.0f; /* r */ + renderer->vertices[i][1][3] = 1.0f; /* q */ + } + + return renderer; +} + +void renderer_destroy(struct renderer *ctx) +{ +#if 0 + if (ctx->fs) { + cso_delete_fragment_shader(ctx->cso, ctx->fs); + ctx->fs = NULL; + } +#endif + free(ctx); +} + +void renderer_draw_quad(struct renderer *r, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat depth) +{ + struct pipe_buffer *buf; + + buf = setup_vertex_data(r, x1, y1, x2, y2, depth); + + if (buf) { + util_draw_vertex_buffer(r->pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference( &buf, + NULL ); + } +} + +void renderer_draw_texture(struct renderer *r, + struct pipe_texture *tex, + VGfloat x1offset, VGfloat y1offset, + VGfloat x2offset, VGfloat y2offset, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2) +{ + struct pipe_context *pipe = r->pipe; + struct pipe_buffer *buf; + VGfloat s0, t0, s1, t1; + + assert(tex->width[0] != 0); + assert(tex->height[0] != 0); + + s0 = x1offset / tex->width[0]; + s1 = x2offset / tex->width[0]; + t0 = y1offset / tex->height[0]; + t1 = y2offset / tex->height[0]; + + cso_save_vertex_shader(r->cso); + /* shaders */ + cso_set_vertex_shader_handle(r->cso, vg_texture_vs(r->owner)); + + /* draw quad */ + buf = setup_vertex_data_tex(r, x1, y1, x2, y2, + s0, t0, s1, t1, 0.0f); + + if (buf) { + util_draw_vertex_buffer(pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference( &buf, + NULL ); + } + + cso_restore_vertex_shader(r->cso); +} + +void renderer_copy_texture(struct renderer *ctx, + struct pipe_texture *src, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + struct pipe_texture *dst, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_buffer *buf; + struct pipe_surface *dst_surf = screen->get_tex_surface( + screen, dst, 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + struct pipe_framebuffer_state fb; + float s0, t0, s1, t1; + + assert(src->width[0] != 0); + assert(src->height[0] != 0); + assert(dst->width[0] != 0); + assert(dst->height[0] != 0); + +#if 0 + debug_printf("copy texture [%f, %f, %f, %f], [%f, %f, %f, %f]\n", + sx1, sy1, sx2, sy2, dx1, dy1, dx2, dy2); +#endif + +#if 1 + s0 = sx1 / src->width[0]; + s1 = sx2 / src->width[0]; + t0 = sy1 / src->height[0]; + t1 = sy2 / src->height[0]; +#else + s0 = 0; + s1 = 1; + t0 = 0; + t1 = 1; +#endif + + assert(screen->is_format_supported(screen, dst_surf->format, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_RENDER_TARGET, 0)); + + /* save state (restored below) */ + cso_save_blend(ctx->cso); + cso_save_samplers(ctx->cso); + cso_save_sampler_textures(ctx->cso); + cso_save_framebuffer(ctx->cso); + cso_save_fragment_shader(ctx->cso); + cso_save_vertex_shader(ctx->cso); + + cso_save_viewport(ctx->cso); + + + /* set misc state we care about */ + { + struct pipe_blend_state blend; + memset(&blend, 0, sizeof(blend)); + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.colormask = PIPE_MASK_RGBA; + cso_set_blend(ctx->cso, &blend); + } + + /* sampler */ + { + struct pipe_sampler_state sampler; + memset(&sampler, 0, sizeof(sampler)); + sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.min_mip_filter = PIPE_TEX_MIPFILTER_NONE; + sampler.min_img_filter = PIPE_TEX_FILTER_NEAREST; + sampler.mag_img_filter = PIPE_TEX_FILTER_NEAREST; + sampler.normalized_coords = 1; + cso_single_sampler(ctx->cso, 0, &sampler); + cso_single_sampler_done(ctx->cso); + } + + vg_set_viewport(ctx->owner, VEGA_Y0_TOP); + + /* texture */ + cso_set_sampler_textures(ctx->cso, 1, &src); + + /* shaders */ + cso_set_vertex_shader_handle(ctx->cso, vg_texture_vs(ctx->owner)); + cso_set_fragment_shader_handle(ctx->cso, ctx->fs); + + /* drawing dest */ + memset(&fb, 0, sizeof(fb)); + fb.width = dst_surf->width; + fb.height = dst_surf->height; + fb.nr_cbufs = 1; + fb.cbufs[0] = dst_surf; + { + VGint i; + for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i) + fb.cbufs[i] = 0; + } + cso_set_framebuffer(ctx->cso, &fb); + + /* draw quad */ + buf = setup_vertex_data_tex(ctx, + dx1, dy1, + dx2, dy2, + s0, t0, s1, t1, + 0.0f); + + if (buf) { + util_draw_vertex_buffer(ctx->pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference( &buf, + NULL ); + } + + /* restore state we changed */ + cso_restore_blend(ctx->cso); + cso_restore_samplers(ctx->cso); + cso_restore_sampler_textures(ctx->cso); + cso_restore_framebuffer(ctx->cso); + cso_restore_vertex_shader(ctx->cso); + cso_restore_fragment_shader(ctx->cso); + cso_restore_viewport(ctx->cso); + + pipe_surface_reference(&dst_surf, NULL); +} + +void renderer_copy_surface(struct renderer *ctx, + struct pipe_surface *src, + int srcX0, int srcY0, + int srcX1, int srcY1, + struct pipe_surface *dst, + int dstX0, int dstY0, + int dstX1, int dstY1, + float z, unsigned filter) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_screen *screen = pipe->screen; + struct pipe_buffer *buf; + struct pipe_texture texTemp, *tex; + struct pipe_surface *texSurf; + struct pipe_framebuffer_state fb; + struct st_framebuffer *stfb = ctx->owner->draw_buffer; + const int srcW = abs(srcX1 - srcX0); + const int srcH = abs(srcY1 - srcY0); + const int srcLeft = MIN2(srcX0, srcX1); + const int srcTop = MIN2(srcY0, srcY1); + + assert(filter == PIPE_TEX_MIPFILTER_NEAREST || + filter == PIPE_TEX_MIPFILTER_LINEAR); + + if (srcLeft != srcX0) { + /* left-right flip */ + int tmp = dstX0; + dstX0 = dstX1; + dstX1 = tmp; + } + + if (srcTop != srcY0) { + /* up-down flip */ + int tmp = dstY0; + dstY0 = dstY1; + dstY1 = tmp; + } + + assert(screen->is_format_supported(screen, src->format, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_SAMPLER, 0)); + assert(screen->is_format_supported(screen, dst->format, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_SAMPLER, 0)); + assert(screen->is_format_supported(screen, dst->format, PIPE_TEXTURE_2D, + PIPE_TEXTURE_USAGE_RENDER_TARGET, 0)); + + /* + * XXX for now we're always creating a temporary texture. + * Strictly speaking that's not always needed. + */ + + /* create temp texture */ + memset(&texTemp, 0, sizeof(texTemp)); + texTemp.target = PIPE_TEXTURE_2D; + texTemp.format = src->format; + texTemp.last_level = 0; + texTemp.width[0] = srcW; + texTemp.height[0] = srcH; + texTemp.depth[0] = 1; + pf_get_block(src->format, &texTemp.block); + + tex = screen->texture_create(screen, &texTemp); + if (!tex) + return; + + texSurf = screen->get_tex_surface(screen, tex, 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + /* load temp texture */ + pipe->surface_copy(pipe, + texSurf, 0, 0, /* dest */ + src, srcLeft, srcTop, /* src */ + srcW, srcH); /* size */ + + /* free the surface, update the texture if necessary.*/ + screen->tex_surface_destroy(texSurf); + + /* save state (restored below) */ + cso_save_blend(ctx->cso); + cso_save_samplers(ctx->cso); + cso_save_sampler_textures(ctx->cso); + cso_save_framebuffer(ctx->cso); + cso_save_fragment_shader(ctx->cso); + cso_save_vertex_shader(ctx->cso); + cso_save_viewport(ctx->cso); + + /* set misc state we care about */ + { + struct pipe_blend_state blend; + memset(&blend, 0, sizeof(blend)); + blend.rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend.alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend.rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend.colormask = PIPE_MASK_RGBA; + cso_set_blend(ctx->cso, &blend); + } + + vg_set_viewport(ctx->owner, VEGA_Y0_TOP); + + /* sampler */ + { + struct pipe_sampler_state sampler; + memset(&sampler, 0, sizeof(sampler)); + sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.wrap_r = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + sampler.min_mip_filter = PIPE_TEX_MIPFILTER_NONE; + sampler.min_img_filter = PIPE_TEX_FILTER_NEAREST; + sampler.mag_img_filter = PIPE_TEX_FILTER_NEAREST; + sampler.normalized_coords = 1; + cso_single_sampler(ctx->cso, 0, &sampler); + cso_single_sampler_done(ctx->cso); + } + + /* texture */ + cso_set_sampler_textures(ctx->cso, 1, &tex); + + /* shaders */ + cso_set_fragment_shader_handle(ctx->cso, ctx->fs); + cso_set_vertex_shader_handle(ctx->cso, vg_texture_vs(ctx->owner)); + + /* drawing dest */ + if (stfb->strb->surface != dst) { + memset(&fb, 0, sizeof(fb)); + fb.width = dst->width; + fb.height = dst->height; + fb.nr_cbufs = 1; + fb.cbufs[0] = dst; + fb.zsbuf = stfb->dsrb->surface; + cso_set_framebuffer(ctx->cso, &fb); + } + + /* draw quad */ + buf = setup_vertex_data(ctx, + (float) dstX0, (float) dstY0, + (float) dstX1, (float) dstY1, z); + + if (buf) { + util_draw_vertex_buffer(ctx->pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference( &buf, + NULL ); + } + + + /* restore state we changed */ + cso_restore_blend(ctx->cso); + cso_restore_samplers(ctx->cso); + cso_restore_sampler_textures(ctx->cso); + cso_restore_framebuffer(ctx->cso); + cso_restore_fragment_shader(ctx->cso); + cso_restore_vertex_shader(ctx->cso); + cso_restore_viewport(ctx->cso); + + pipe_texture_reference(&tex, NULL); +} + +void renderer_texture_quad(struct renderer *r, + struct pipe_texture *tex, + VGfloat x1offset, VGfloat y1offset, + VGfloat x2offset, VGfloat y2offset, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat x3, VGfloat y3, + VGfloat x4, VGfloat y4) +{ + struct pipe_context *pipe = r->pipe; + struct pipe_buffer *buf; + VGfloat s0, t0, s1, t1; + + assert(tex->width[0] != 0); + assert(tex->height[0] != 0); + + s0 = x1offset / tex->width[0]; + s1 = x2offset / tex->width[0]; + t0 = y1offset / tex->height[0]; + t1 = y2offset / tex->height[0]; + + cso_save_vertex_shader(r->cso); + /* shaders */ + cso_set_vertex_shader_handle(r->cso, vg_texture_vs(r->owner)); + + /* draw quad */ + buf = setup_vertex_data_qtex(r, x1, y1, x2, y2, x3, y3, x4, y4, + s0, t0, s1, t1, 0.0f); + + if (buf) { + util_draw_vertex_buffer(pipe, buf, 0, + PIPE_PRIM_TRIANGLE_FAN, + 4, /* verts */ + 2); /* attribs/vert */ + + pipe_buffer_reference(&buf, + NULL); + } + + cso_restore_vertex_shader(r->cso); +} diff --git a/src/gallium/state_trackers/vega/renderer.h b/src/gallium/state_trackers/vega/renderer.h new file mode 100644 index 0000000000..990cd32c31 --- /dev/null +++ b/src/gallium/state_trackers/vega/renderer.h @@ -0,0 +1,76 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef RENDERER_H +#define RENDERER_H + +#include "VG/openvg.h" + +struct renderer; + +struct vg_context; +struct pipe_texture; +struct pipe_surface; + +struct renderer *renderer_create(struct vg_context *owner); +void renderer_destroy(struct renderer *); + +void renderer_draw_quad(struct renderer *, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat depth); +void renderer_draw_texture(struct renderer *, + struct pipe_texture *texture, + VGfloat x1offset, VGfloat y1offset, + VGfloat x2offset, VGfloat y2offset, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2); +void renderer_texture_quad(struct renderer *, + struct pipe_texture *texture, + VGfloat x1offset, VGfloat y1offset, + VGfloat x2offset, VGfloat y2offset, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat x3, VGfloat y3, + VGfloat x4, VGfloat y4); +void renderer_copy_texture(struct renderer *r, + struct pipe_texture *src, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + struct pipe_texture *dst, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2); +void renderer_copy_surface(struct renderer *r, + struct pipe_surface *src, + int sx1, int sy1, + int sx2, int sy2, + struct pipe_surface *dst, + int dx1, int dy1, + int dx2, int dy2, + float z, unsigned filter); + + +#endif diff --git a/src/gallium/state_trackers/vega/shader.c b/src/gallium/state_trackers/vega/shader.c new file mode 100644 index 0000000000..d9074a377b --- /dev/null +++ b/src/gallium/state_trackers/vega/shader.c @@ -0,0 +1,310 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "shader.h" + +#include "vg_context.h" +#include "shaders_cache.h" +#include "paint.h" +#include "mask.h" +#include "image.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_state.h" +#include "pipe/p_inlines.h" +#include "util/u_memory.h" + +#define MAX_CONSTANTS 20 + +struct shader { + struct vg_context *context; + + VGboolean masking; + struct vg_paint *paint; + struct vg_image *image; + + VGboolean drawing_image; + VGImageMode image_mode; + + float constants[MAX_CONSTANTS]; + struct pipe_constant_buffer cbuf; + struct pipe_shader_state fs_state; + void *fs; +}; + +struct shader * shader_create(struct vg_context *ctx) +{ + struct shader *shader = 0; + + shader = CALLOC_STRUCT(shader); + shader->context = ctx; + + return shader; +} + +void shader_destroy(struct shader *shader) +{ + free(shader); +} + +void shader_set_masking(struct shader *shader, VGboolean set) +{ + shader->masking = set; +} + +VGboolean shader_is_masking(struct shader *shader) +{ + return shader->masking; +} + +void shader_set_paint(struct shader *shader, struct vg_paint *paint) +{ + shader->paint = paint; +} + +struct vg_paint * shader_paint(struct shader *shader) +{ + return shader->paint; +} + + +static void setup_constant_buffer(struct shader *shader) +{ + struct vg_context *ctx = shader->context; + struct pipe_context *pipe = shader->context->pipe; + struct pipe_constant_buffer *cbuf = &shader->cbuf; + VGint param_bytes = paint_constant_buffer_size(shader->paint); + float temp_buf[MAX_CONSTANTS]; + + assert(param_bytes <= sizeof(temp_buf)); + paint_fill_constant_buffer(shader->paint, temp_buf); + + if (cbuf->buffer == NULL || + memcmp(temp_buf, shader->constants, param_bytes) != 0) + { + pipe_buffer_reference(&cbuf->buffer, NULL); + + memcpy(shader->constants, temp_buf, param_bytes); + cbuf->buffer = pipe_user_buffer_create(pipe->screen, + &shader->constants, + sizeof(shader->constants)); + } + + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_FRAGMENT, 0, cbuf); +} + +static VGint blend_bind_samplers(struct vg_context *ctx, + struct pipe_sampler_state **samplers, + struct pipe_texture **textures) +{ + VGBlendMode bmode = ctx->state.vg.blend_mode; + + if (bmode == VG_BLEND_MULTIPLY || + bmode == VG_BLEND_SCREEN || + bmode == VG_BLEND_DARKEN || + bmode == VG_BLEND_LIGHTEN) { + struct st_framebuffer *stfb = ctx->draw_buffer; + + vg_prepare_blend_surface(ctx); + + samplers[2] = &ctx->blend_sampler; + textures[2] = stfb->blend_texture; + + if (!samplers[0] || !textures[0]) { + samplers[1] = samplers[2]; + textures[1] = textures[2]; + } + if (!samplers[1] || !textures[1]) { + samplers[1] = samplers[0]; + textures[1] = textures[0]; + } + + return 1; + } + return 0; +} + +static void setup_samplers(struct shader *shader) +{ + struct pipe_sampler_state *samplers[PIPE_MAX_SAMPLERS]; + struct pipe_texture *textures[PIPE_MAX_SAMPLERS]; + struct vg_context *ctx = shader->context; + /* a little wonky: we use the num as a boolean that just says + * whether any sampler/textures have been set. the actual numbering + * for samplers is always the same: + * 0 - paint sampler/texture for gradient/pattern + * 1 - mask sampler/texture + * 2 - blend sampler/texture + * 3 - image sampler/texture + * */ + VGint num = 0; + + samplers[0] = NULL; + samplers[1] = NULL; + samplers[2] = NULL; + samplers[3] = NULL; + textures[0] = NULL; + textures[1] = NULL; + textures[2] = NULL; + textures[3] = NULL; + + num += paint_bind_samplers(shader->paint, samplers, textures); + num += mask_bind_samplers(samplers, textures); + num += blend_bind_samplers(ctx, samplers, textures); + if (shader->drawing_image && shader->image) + num += image_bind_samplers(shader->image, samplers, textures); + + if (num) { + cso_set_samplers(ctx->cso_context, 4, (const struct pipe_sampler_state **)samplers); + cso_set_sampler_textures(ctx->cso_context, 4, textures); + } +} + +static INLINE VGboolean is_format_bw(struct shader *shader) +{ +#if 0 + struct vg_context *ctx = shader->context; + struct st_framebuffer *stfb = ctx->draw_buffer; +#endif + + if (shader->drawing_image && shader->image) { + if (shader->image->format == VG_BW_1) + return VG_TRUE; + } + + return VG_FALSE; +} + +static void setup_shader_program(struct shader *shader) +{ + struct vg_context *ctx = shader->context; + VGint shader_id = 0; + VGBlendMode blend_mode = ctx->state.vg.blend_mode; + VGboolean black_white = is_format_bw(shader); + + /* 1st stage: fill */ + if (!shader->drawing_image || + (shader->image_mode == VG_DRAW_IMAGE_MULTIPLY || shader->image_mode == VG_DRAW_IMAGE_STENCIL)) { + switch(paint_type(shader->paint)) { + case VG_PAINT_TYPE_COLOR: + shader_id |= VEGA_SOLID_FILL_SHADER; + break; + case VG_PAINT_TYPE_LINEAR_GRADIENT: + shader_id |= VEGA_LINEAR_GRADIENT_SHADER; + break; + case VG_PAINT_TYPE_RADIAL_GRADIENT: + shader_id |= VEGA_RADIAL_GRADIENT_SHADER; + break; + case VG_PAINT_TYPE_PATTERN: + shader_id |= VEGA_PATTERN_SHADER; + break; + + default: + abort(); + } + } + + /* second stage image */ + if (shader->drawing_image) { + switch(shader->image_mode) { + case VG_DRAW_IMAGE_NORMAL: + shader_id |= VEGA_IMAGE_NORMAL_SHADER; + break; + case VG_DRAW_IMAGE_MULTIPLY: + shader_id |= VEGA_IMAGE_MULTIPLY_SHADER; + break; + case VG_DRAW_IMAGE_STENCIL: + shader_id |= VEGA_IMAGE_STENCIL_SHADER; + break; + default: + debug_printf("Unknown image mode!"); + } + } + + if (shader->masking) + shader_id |= VEGA_MASK_SHADER; + + switch(blend_mode) { + case VG_BLEND_MULTIPLY: + shader_id |= VEGA_BLEND_MULTIPLY_SHADER; + break; + case VG_BLEND_SCREEN: + shader_id |= VEGA_BLEND_SCREEN_SHADER; + break; + case VG_BLEND_DARKEN: + shader_id |= VEGA_BLEND_DARKEN_SHADER; + break; + case VG_BLEND_LIGHTEN: + shader_id |= VEGA_BLEND_LIGHTEN_SHADER; + break; + default: + /* handled by pipe_blend_state */ + break; + } + + if (black_white) + shader_id |= VEGA_BW_SHADER; + + shader->fs = shaders_cache_fill(ctx->sc, shader_id); + cso_set_fragment_shader_handle(ctx->cso_context, shader->fs); +} + + +void shader_bind(struct shader *shader) +{ + /* first resolve the real paint type */ + paint_resolve_type(shader->paint); + + setup_constant_buffer(shader); + setup_samplers(shader); + setup_shader_program(shader); +} + +void shader_set_image_mode(struct shader *shader, VGImageMode image_mode) +{ + shader->image_mode = image_mode; +} + +VGImageMode shader_image_mode(struct shader *shader) +{ + return shader->image_mode; +} + +void shader_set_drawing_image(struct shader *shader, VGboolean drawing_image) +{ + shader->drawing_image = drawing_image; +} + +VGboolean shader_drawing_image(struct shader *shader) +{ + return shader->drawing_image; +} + +void shader_set_image(struct shader *shader, struct vg_image *img) +{ + shader->image = img; +} diff --git a/src/gallium/state_trackers/vega/shader.h b/src/gallium/state_trackers/vega/shader.h new file mode 100644 index 0000000000..847eee6a31 --- /dev/null +++ b/src/gallium/state_trackers/vega/shader.h @@ -0,0 +1,56 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef SHADER_H +#define SHADER_H + +#include "VG/openvg.h" + +struct shader; +struct vg_paint; +struct vg_context; +struct vg_image; + +struct shader *shader_create(struct vg_context *context); +void shader_destroy(struct shader *shader); + +void shader_set_masking(struct shader *shader, VGboolean set); +VGboolean shader_is_masking(struct shader *shader); + +void shader_set_paint(struct shader *shader, struct vg_paint *paint); +struct vg_paint *shader_paint(struct shader *shader); + +void shader_set_image_mode(struct shader *shader, VGImageMode image_mode); +VGImageMode shader_image_mode(struct shader *shader); + +void shader_set_drawing_image(struct shader *shader, VGboolean drawing_image); +VGboolean shader_drawing_image(struct shader *shader); + +void shader_set_image(struct shader *shader, struct vg_image *img); + +void shader_bind(struct shader *shader); + +#endif diff --git a/src/gallium/state_trackers/vega/shaders_cache.c b/src/gallium/state_trackers/vega/shaders_cache.c new file mode 100644 index 0000000000..fd0831fab1 --- /dev/null +++ b/src/gallium/state_trackers/vega/shaders_cache.c @@ -0,0 +1,439 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "shaders_cache.h" + +#include "vg_context.h" + +#include "pipe/p_context.h" +#include "pipe/p_defines.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" +#include "pipe/p_shader_tokens.h" + +#include "tgsi/tgsi_build.h" +#include "tgsi/tgsi_dump.h" +#include "tgsi/tgsi_parse.h" +#include "tgsi/tgsi_util.h" +#include "tgsi/tgsi_text.h" + +#include "util/u_memory.h" +#include "util/u_math.h" +#include "util/u_debug.h" +#include "cso_cache/cso_hash.h" +#include "cso_cache/cso_context.h" + +#include "VG/openvg.h" + +#include "asm_fill.h" + +/* Essentially we construct an ubber-shader based on the state + * of the pipeline. The stages are: + * 1) Fill (mandatory, solid color/gradient/pattern/image draw) + * 2) Image composition (image mode multiply and stencil) + * 3) Mask + * 4) Extended blend (multiply/screen/darken/lighten) + * 5) Premultiply/Unpremultiply + * 6) Color transform (to black and white) + */ +#define SHADER_STAGES 6 + +struct cached_shader { + void *driver_shader; + struct pipe_shader_state state; +}; + +struct shaders_cache { + struct vg_context *pipe; + + struct cso_hash *hash; +}; + + +static INLINE struct tgsi_token *tokens_from_assembly(const char *txt, int num_tokens) +{ + struct tgsi_token *tokens; + + tokens = (struct tgsi_token *) MALLOC(num_tokens * sizeof(tokens[0])); + + tgsi_text_translate(txt, tokens, num_tokens); + +#if DEBUG_SHADERS + tgsi_dump(tokens, 0); +#endif + + return tokens; +} + +#define ALL_FILLS (VEGA_SOLID_FILL_SHADER | \ + VEGA_LINEAR_GRADIENT_SHADER | \ + VEGA_RADIAL_GRADIENT_SHADER | \ + VEGA_PATTERN_SHADER | \ + VEGA_IMAGE_NORMAL_SHADER) + + +/* +static const char max_shader_preamble[] = + "FRAG1.1\n" + "DCL IN[0], POSITION, LINEAR\n" + "DCL IN[1], GENERIC[0], PERSPECTIVE\n" + "DCL OUT[0], COLOR, CONSTANT\n" + "DCL CONST[0..9], CONSTANT\n" + "DCL TEMP[0..9], CONSTANT\n" + "DCL SAMP[0..9], CONSTANT\n"; + + max_shader_preamble strlen == 175 +*/ +#define MAX_PREAMBLE 175 + +static INLINE VGint range_min(VGint min, VGint current) +{ + if (min < 0) + min = current; + else + min = MIN2(min, current); + return min; +} + +static INLINE VGint range_max(VGint max, VGint current) +{ + return MAX2(max, current); +} + +static void +create_preamble(char *txt, + const struct shader_asm_info *shaders[SHADER_STAGES], + int num_shaders) +{ + VGboolean declare_input = VG_FALSE; + VGint start_const = -1, end_const = 0; + VGint start_temp = -1, end_temp = 0; + VGint start_sampler = -1, end_sampler = 0; + VGint i; + VGint num_consts, num_temps, num_samplers; + + for (i = 0; i < num_shaders; ++i) { + if (shaders[i]->num_consts) + start_const = range_min(start_const, shaders[i]->start_const); + if (shaders[i]->num_temps) + start_temp = range_min(start_temp, shaders[i]->start_temp); + if (shaders[i]->num_samplers) + start_sampler = range_min(start_sampler, shaders[i]->start_sampler); + + end_const = range_max(end_const, shaders[i]->start_const + + shaders[i]->num_consts); + end_temp = range_max(end_temp, shaders[i]->start_temp + + shaders[i]->num_temps); + end_sampler = range_max(end_sampler, shaders[i]->start_sampler + + shaders[i]->num_samplers); + if (shaders[i]->needs_position) + declare_input = VG_TRUE; + } + /* if they're still unitialized, initialize them */ + if (start_const < 0) + start_const = 0; + if (start_temp < 0) + start_temp = 0; + if (start_sampler < 0) + start_sampler = 0; + + num_consts = end_const - start_const; + num_temps = end_temp - start_temp; + num_samplers = end_sampler - start_sampler; + /* end exclusive */ + --end_const; + --end_temp; + --end_sampler; + + sprintf(txt, "FRAG1.1\n"); + + if (declare_input) { + sprintf(txt + strlen(txt), "DCL IN[0], POSITION, LINEAR\n"); + sprintf(txt + strlen(txt), "DCL IN[1], GENERIC[0], PERSPECTIVE\n"); + } + + /* we always have a color output */ + sprintf(txt + strlen(txt), "DCL OUT[0], COLOR, CONSTANT\n"); + + if (num_consts > 1) + sprintf(txt + strlen(txt), "DCL CONST[%d..%d], CONSTANT\n", start_const, end_const); + else if (num_consts == 1) + sprintf(txt + strlen(txt), "DCL CONST[%d], CONSTANT\n", start_const); + + if (num_temps > 1) + sprintf(txt + strlen(txt), "DCL TEMP[%d..%d], CONSTANT\n", start_temp, end_temp); + else if (num_temps > 1) + sprintf(txt + strlen(txt), "DCL TEMP[%d], CONSTANT\n", start_temp); + + if (num_samplers > 1) + sprintf(txt + strlen(txt), "DCL SAMP[%d..%d], CONSTANT\n", start_sampler, end_sampler); + else if (num_samplers == 1) + sprintf(txt + strlen(txt), "DCL SAMP[%d], CONSTANT\n", start_sampler); +} + +static void * +combine_shaders(const struct shader_asm_info *shaders[SHADER_STAGES], int num_shaders, + struct pipe_context *pipe, + struct pipe_shader_state *shader) +{ + char *combined_txt; + int combined_len = MAX_PREAMBLE; + int combined_tokens = 0; + int i = 0; + int current_shader = 0; + int current_len; + + for (i = 0; i < num_shaders; ++i) { + combined_len += strlen(shaders[i]->txt); + combined_tokens += shaders[i]->num_tokens; + } + /* add for the %s->TEMP[0] substitutions */ + combined_len += num_shaders * 7 /*TEMP[0]*/ + 4 /*"END\n"*/; + + combined_txt = (char*)malloc(combined_len); + combined_txt[0] = '\0'; + + create_preamble(combined_txt, shaders, num_shaders); + + while (current_shader < num_shaders) { + const char temp[] = "TEMP[0]"; + const char out[] = "OUT[0]"; + const char *subst = temp; + + current_len = strlen(combined_txt); + + /* if the last shader then output */ + if (current_shader + 1 == num_shaders) + subst = out; + + snprintf(combined_txt + current_len, + combined_len - current_len, + shaders[current_shader]->txt, + subst); + ++current_shader; + } + + + current_len = strlen(combined_txt); + snprintf(combined_txt + current_len, + combined_len - current_len, + "END\n"); + + debug_printf("Combined shader is : \n%s\n", + combined_txt); + + shader->tokens = tokens_from_assembly( + combined_txt, combined_tokens); + + free(combined_txt); + + return pipe->create_fs_state(pipe, shader); +} + +static void * +create_shader(struct pipe_context *pipe, + int id, + struct pipe_shader_state *shader) +{ + int idx = 0; + const struct shader_asm_info * shaders[SHADER_STAGES]; + + /* the shader has to have a fill */ + debug_assert(id & ALL_FILLS); + + /* first stage */ + if (id & VEGA_SOLID_FILL_SHADER) { + debug_assert(idx == 0); + shaders[idx] = &shaders_asm[0]; + debug_assert(shaders_asm[0].id == VEGA_SOLID_FILL_SHADER); + ++idx; + } + if ((id & VEGA_LINEAR_GRADIENT_SHADER)) { + debug_assert(idx == 0); + shaders[idx] = &shaders_asm[1]; + debug_assert(shaders_asm[1].id == VEGA_LINEAR_GRADIENT_SHADER); + ++idx; + } + if ((id & VEGA_RADIAL_GRADIENT_SHADER)) { + debug_assert(idx == 0); + shaders[idx] = &shaders_asm[2]; + debug_assert(shaders_asm[2].id == VEGA_RADIAL_GRADIENT_SHADER); + ++idx; + } + if ((id & VEGA_PATTERN_SHADER)) { + debug_assert(idx == 0); + debug_assert(shaders_asm[3].id == VEGA_PATTERN_SHADER); + shaders[idx] = &shaders_asm[3]; + ++idx; + } + if ((id & VEGA_IMAGE_NORMAL_SHADER)) { + debug_assert(idx == 0); + debug_assert(shaders_asm[4].id == VEGA_IMAGE_NORMAL_SHADER); + shaders[idx] = &shaders_asm[4]; + ++idx; + } + + /* second stage */ + if ((id & VEGA_IMAGE_MULTIPLY_SHADER)) { + debug_assert(shaders_asm[5].id == VEGA_IMAGE_MULTIPLY_SHADER); + shaders[idx] = &shaders_asm[5]; + ++idx; + } else if ((id & VEGA_IMAGE_STENCIL_SHADER)) { + debug_assert(shaders_asm[6].id == VEGA_IMAGE_STENCIL_SHADER); + shaders[idx] = &shaders_asm[6]; + ++idx; + } + + /* third stage */ + if ((id & VEGA_MASK_SHADER)) { + debug_assert(idx == 1); + debug_assert(shaders_asm[7].id == VEGA_MASK_SHADER); + shaders[idx] = &shaders_asm[7]; + ++idx; + } + + /* fourth stage */ + if ((id & VEGA_BLEND_MULTIPLY_SHADER)) { + debug_assert(shaders_asm[8].id == VEGA_BLEND_MULTIPLY_SHADER); + shaders[idx] = &shaders_asm[8]; + ++idx; + } else if ((id & VEGA_BLEND_SCREEN_SHADER)) { + debug_assert(shaders_asm[9].id == VEGA_BLEND_SCREEN_SHADER); + shaders[idx] = &shaders_asm[9]; + ++idx; + } else if ((id & VEGA_BLEND_DARKEN_SHADER)) { + debug_assert(shaders_asm[10].id == VEGA_BLEND_DARKEN_SHADER); + shaders[idx] = &shaders_asm[10]; + ++idx; + } else if ((id & VEGA_BLEND_LIGHTEN_SHADER)) { + debug_assert(shaders_asm[11].id == VEGA_BLEND_LIGHTEN_SHADER); + shaders[idx] = &shaders_asm[11]; + ++idx; + } + + /* fifth stage */ + if ((id & VEGA_PREMULTIPLY_SHADER)) { + debug_assert(shaders_asm[12].id == VEGA_PREMULTIPLY_SHADER); + shaders[idx] = &shaders_asm[12]; + ++idx; + } else if ((id & VEGA_UNPREMULTIPLY_SHADER)) { + debug_assert(shaders_asm[13].id == VEGA_UNPREMULTIPLY_SHADER); + shaders[idx] = &shaders_asm[13]; + ++idx; + } + + /* sixth stage */ + if ((id & VEGA_BW_SHADER)) { + debug_assert(shaders_asm[14].id == VEGA_BW_SHADER); + shaders[idx] = &shaders_asm[14]; + ++idx; + } + + return combine_shaders(shaders, idx, pipe, shader); +} + +/*************************************************/ + +struct shaders_cache * shaders_cache_create(struct vg_context *vg) +{ + struct shaders_cache *sc = CALLOC_STRUCT(shaders_cache); + + sc->pipe = vg; + sc->hash = cso_hash_create(); + + return sc; +} + +void shaders_cache_destroy(struct shaders_cache *sc) +{ + struct cso_hash_iter iter = cso_hash_first_node(sc->hash); + + while (!cso_hash_iter_is_null(iter)) { + struct cached_shader *cached = + (struct cached_shader *)cso_hash_iter_data(iter); + cso_delete_fragment_shader(sc->pipe->cso_context, + cached->driver_shader); + iter = cso_hash_erase(sc->hash, iter); + } + + cso_hash_delete(sc->hash); + free(sc); +} + +void * shaders_cache_fill(struct shaders_cache *sc, + int shader_key) +{ + VGint key = shader_key; + struct cached_shader *cached; + struct cso_hash_iter iter = cso_hash_find(sc->hash, key); + + if (cso_hash_iter_is_null(iter)) { + cached = CALLOC_STRUCT(cached_shader); + cached->driver_shader = create_shader(sc->pipe->pipe, key, &cached->state); + + cso_hash_insert(sc->hash, key, cached); + + return cached->driver_shader; + } + + cached = (struct cached_shader *)cso_hash_iter_data(iter); + + assert(cached->driver_shader); + return cached->driver_shader; +} + +struct vg_shader * shader_create_from_text(struct pipe_context *pipe, + const char *txt, int num_tokens, + int type) +{ + struct vg_shader *shader = (struct vg_shader *)malloc( + sizeof(struct vg_shader)); + struct tgsi_token *tokens = tokens_from_assembly(txt, num_tokens); + struct pipe_shader_state state; + + debug_assert(type == PIPE_SHADER_VERTEX || + type == PIPE_SHADER_FRAGMENT); + + state.tokens = tokens; + shader->type = type; + shader->tokens = tokens; + + if (type == PIPE_SHADER_FRAGMENT) + shader->driver = pipe->create_fs_state(pipe, &state); + else + shader->driver = pipe->create_vs_state(pipe, &state); + return shader; +} + +void vg_shader_destroy(struct vg_context *ctx, struct vg_shader *shader) +{ + if (shader->type == PIPE_SHADER_FRAGMENT) + cso_delete_fragment_shader(ctx->cso_context, shader->driver); + else + cso_delete_vertex_shader(ctx->cso_context, shader->driver); + free(shader->tokens); + free(shader); +} diff --git a/src/gallium/state_trackers/vega/shaders_cache.h b/src/gallium/state_trackers/vega/shaders_cache.h new file mode 100644 index 0000000000..feca58b61a --- /dev/null +++ b/src/gallium/state_trackers/vega/shaders_cache.h @@ -0,0 +1,77 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef SHADERS_CACHE_H +#define SHADERS_CACHE_H + + +struct vg_context; +struct pipe_context; +struct tgsi_token; +struct shaders_cache; + +enum VegaShaderType { + VEGA_SOLID_FILL_SHADER = 1 << 0, + VEGA_LINEAR_GRADIENT_SHADER = 1 << 1, + VEGA_RADIAL_GRADIENT_SHADER = 1 << 2, + VEGA_PATTERN_SHADER = 1 << 3, + VEGA_IMAGE_NORMAL_SHADER = 1 << 4, + VEGA_IMAGE_MULTIPLY_SHADER = 1 << 5, + VEGA_IMAGE_STENCIL_SHADER = 1 << 6, + + VEGA_MASK_SHADER = 1 << 7, + + VEGA_BLEND_MULTIPLY_SHADER = 1 << 8, + VEGA_BLEND_SCREEN_SHADER = 1 << 9, + VEGA_BLEND_DARKEN_SHADER = 1 << 10, + VEGA_BLEND_LIGHTEN_SHADER = 1 << 11, + + VEGA_PREMULTIPLY_SHADER = 1 << 12, + VEGA_UNPREMULTIPLY_SHADER = 1 << 13, + + VEGA_BW_SHADER = 1 << 14 +}; + +struct vg_shader { + void *driver; + struct tgsi_token *tokens; + int type;/* PIPE_SHADER_VERTEX, PIPE_SHADER_FRAGMENT */ +}; + +struct shaders_cache *shaders_cache_create(struct vg_context *pipe); +void shaders_cache_destroy(struct shaders_cache *sc); +void *shaders_cache_fill(struct shaders_cache *sc, + int shader_key); + +struct vg_shader *shader_create_from_text(struct pipe_context *pipe, + const char *txt, int num_tokens, + int type); + +void vg_shader_destroy(struct vg_context *ctx, struct vg_shader *shader); + + + +#endif diff --git a/src/gallium/state_trackers/vega/st_inlines.h b/src/gallium/state_trackers/vega/st_inlines.h new file mode 100644 index 0000000000..1f331dfcdb --- /dev/null +++ b/src/gallium/state_trackers/vega/st_inlines.h @@ -0,0 +1,159 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. + * All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +/** + * Functions for checking if buffers/textures are referenced when we need + * to read/write from/to them. Flush when needed. + */ + +#ifndef ST_INLINES_H +#define ST_INLINES_H + +#include "vg_context.h" + +#include "pipe/p_context.h" +#include "pipe/p_screen.h" +#include "pipe/p_defines.h" +#include "pipe/p_inlines.h" +#include "pipe/p_state.h" + +static INLINE struct pipe_transfer * +st_cond_flush_get_tex_transfer(struct vg_context *st, + struct pipe_texture *pt, + unsigned int face, + unsigned int level, + unsigned int zslice, + enum pipe_transfer_usage usage, + unsigned int x, unsigned int y, + unsigned int w, unsigned int h) +{ + struct pipe_screen *screen = st->pipe->screen; + struct pipe_context *pipe = st->pipe; + unsigned referenced = + pipe->is_texture_referenced(pipe, pt, face, level); + + if (referenced && ((referenced & PIPE_REFERENCED_FOR_WRITE) || + usage == PIPE_TRANSFER_WRITE || + usage == PIPE_TRANSFER_READ_WRITE)) + vgFlush(); + + return screen->get_tex_transfer(screen, pt, face, level, zslice, usage, + x, y, w, h); +} + +static INLINE struct pipe_transfer * +st_no_flush_get_tex_transfer(struct vg_context *st, + struct pipe_texture *pt, + unsigned int face, + unsigned int level, + unsigned int zslice, + enum pipe_transfer_usage usage, + unsigned int x, unsigned int y, + unsigned int w, unsigned int h) +{ + struct pipe_screen *screen = st->pipe->screen; + + return screen->get_tex_transfer(screen, pt, face, level, + zslice, usage, x, y, w, h); +} + +static INLINE void * +st_cond_flush_pipe_buffer_map(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int map_flags) +{ + struct pipe_context *pipe = st->pipe; + unsigned int referenced = pipe->is_buffer_referenced(pipe, buf); + + if (referenced && ((referenced & PIPE_REFERENCED_FOR_WRITE) || + (map_flags & PIPE_BUFFER_USAGE_CPU_WRITE))) + vgFlush(); + + return pipe_buffer_map(pipe->screen, buf, map_flags); +} + +static INLINE void * +st_no_flush_pipe_buffer_map(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int map_flags) +{ + return pipe_buffer_map(st->pipe->screen, buf, map_flags); +} + + +static INLINE void +st_cond_flush_pipe_buffer_write(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int offset, + unsigned int size, + const void * data) +{ + struct pipe_context *pipe = st->pipe; + + if (pipe->is_buffer_referenced(pipe, buf)) + vgFlush(); + + pipe_buffer_write(pipe->screen, buf, offset, size, data); +} + +static INLINE void +st_no_flush_pipe_buffer_write(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int offset, + unsigned int size, + const void * data) +{ + pipe_buffer_write(st->pipe->screen, buf, offset, size, data); +} + +static INLINE void +st_cond_flush_pipe_buffer_read(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int offset, + unsigned int size, + void * data) +{ + struct pipe_context *pipe = st->pipe; + + if (pipe->is_buffer_referenced(pipe, buf) & PIPE_REFERENCED_FOR_WRITE) + vgFlush(); + + pipe_buffer_read(pipe->screen, buf, offset, size, data); +} + +static INLINE void +st_no_flush_pipe_buffer_read(struct vg_context *st, + struct pipe_buffer *buf, + unsigned int offset, + unsigned int size, + void * data) +{ + pipe_buffer_read(st->pipe->screen, buf, offset, size, data); +} + +#endif + diff --git a/src/gallium/state_trackers/vega/stroker.c b/src/gallium/state_trackers/vega/stroker.c new file mode 100644 index 0000000000..1b92d2b5c6 --- /dev/null +++ b/src/gallium/state_trackers/vega/stroker.c @@ -0,0 +1,1349 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "stroker.h" + +#include "path.h" +#include "vg_state.h" +#include "util_array.h" +#include "arc.h" +#include "bezier.h" +#include "matrix.h" +#include "path_utils.h" +#include "polygon.h" + +#include "math.h" + +#ifndef M_2PI +#define M_2PI 6.28318530717958647692528676655900576 +#endif + +#define STROKE_SEGMENTS 0 +#define STROKE_DEBUG 0 +#define DEBUG_EMITS 0 + +static const VGfloat curve_threshold = 0.25f; + +static const VGfloat zero_coords[] = {0.f, 0.f}; + +enum intersection_type { + NoIntersections, + BoundedIntersection, + UnboundedIntersection, +}; + +enum line_join_mode { + FlatJoin, + SquareJoin, + MiterJoin, + RoundJoin, + RoundCap +}; + +struct stroke_iterator { + void (*next)(struct stroke_iterator *); + VGboolean (*has_next)(struct stroke_iterator *); + + VGPathCommand (*current_command)(struct stroke_iterator *it); + void (*current_coords)(struct stroke_iterator *it, VGfloat *coords); + + VGint position; + VGint coord_position; + + const VGubyte *cmds; + const VGfloat *coords; + VGint num_commands; + VGint num_coords; + + struct polygon *curve_poly; + VGint curve_index; +}; + +static VGPathCommand stroke_itr_command(struct stroke_iterator *itr) +{ + return itr->current_command(itr); +} + +static void stroke_itr_coords(struct stroke_iterator *itr, VGfloat *coords) +{ + itr->current_coords(itr, coords); +} + +static void stroke_fw_itr_coords(struct stroke_iterator *itr, VGfloat *coords) +{ + if (itr->position >= itr->num_commands) + return; + switch (stroke_itr_command(itr)) { + case VG_MOVE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_LINE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_CUBIC_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + coords[2] = itr->coords[itr->coord_position + 2]; + coords[3] = itr->coords[itr->coord_position + 3]; + coords[4] = itr->coords[itr->coord_position + 4]; + coords[5] = itr->coords[itr->coord_position + 5]; + break; + default: + debug_assert(!"invalid command!\n"); + } +} + + +static void stroke_bw_itr_coords(struct stroke_iterator *itr, VGfloat *coords) +{ + if (itr->position >= itr->num_commands) + return; + switch (stroke_itr_command(itr)) { + case VG_MOVE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_LINE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_CUBIC_TO_ABS: + coords[0] = itr->coords[itr->coord_position + 4]; + coords[1] = itr->coords[itr->coord_position + 5]; + coords[2] = itr->coords[itr->coord_position + 2]; + coords[3] = itr->coords[itr->coord_position + 3]; + coords[4] = itr->coords[itr->coord_position + 0]; + coords[5] = itr->coords[itr->coord_position + 1]; + break; + default: + debug_assert(!"invalid command!\n"); + } +} + + +static VGPathCommand stroke_fw_current_command(struct stroke_iterator *it) +{ + return it->cmds[it->position]; +} + +static VGPathCommand stroke_bw_current_command(struct stroke_iterator *it) +{ + VGPathCommand prev_cmd; + if (it->position == it->num_commands -1) + return VG_MOVE_TO_ABS; + + prev_cmd = it->cmds[it->position + 1]; + return prev_cmd; +} + +static VGboolean stroke_fw_has_next(struct stroke_iterator *itr) +{ + return itr->position < (itr->num_commands - 1); +} + +static VGboolean stroke_bw_has_next(struct stroke_iterator *itr) +{ + return itr->position > 0; +} + +static void stroke_fw_next(struct stroke_iterator *itr) +{ + VGubyte cmd; + debug_assert(stroke_fw_has_next(itr)); + + cmd = stroke_itr_command(itr); + + itr->coord_position += num_elements_for_segments(&cmd, 1); + ++itr->position; +} + +static void stroke_bw_next(struct stroke_iterator *itr) +{ + VGubyte cmd; + debug_assert(stroke_bw_has_next(itr)); + + --itr->position; + cmd = stroke_itr_command(itr); + + itr->coord_position -= num_elements_for_segments(&cmd, 1); +} + +static void stroke_itr_common_init(struct stroke_iterator *itr, + struct array *cmds, + struct array *coords) +{ + itr->cmds = (VGubyte*)cmds->data; + itr->num_commands = cmds->num_elements; + + itr->coords = (VGfloat*)coords->data; + itr->num_coords = coords->num_elements; +} + +static void stroke_forward_iterator(struct stroke_iterator *itr, + struct array *cmds, + struct array *coords) +{ + stroke_itr_common_init(itr, cmds, coords); + itr->position = 0; + itr->coord_position = 0; + + itr->next = stroke_fw_next; + itr->has_next = stroke_fw_has_next; + itr->current_command = stroke_fw_current_command; + itr->current_coords = stroke_fw_itr_coords; +} + +static void stroke_backward_iterator(struct stroke_iterator *itr, + struct array *cmds, + struct array *coords) +{ + VGubyte cmd; + stroke_itr_common_init(itr, cmds, coords); + itr->position = itr->num_commands - 1; + + cmd = stroke_bw_current_command(itr); + itr->coord_position = itr->num_coords - + num_elements_for_segments(&cmd, 1); + + itr->next = stroke_bw_next; + itr->has_next = stroke_bw_has_next; + itr->current_command = stroke_bw_current_command; + itr->current_coords = stroke_bw_itr_coords; +} + + + +static void stroke_flat_next(struct stroke_iterator *itr) +{ + VGubyte cmd; + + if (itr->curve_index >= 0) { + ++itr->curve_index; + if (itr->curve_index >= polygon_vertex_count(itr->curve_poly)) { + itr->curve_index = -1; + polygon_destroy(itr->curve_poly); + itr->curve_poly = 0; + } else + return; + } + debug_assert(stroke_fw_has_next(itr)); + + cmd = itr->cmds[itr->position]; + itr->coord_position += num_elements_for_segments(&cmd, 1); + ++itr->position; + + cmd = itr->cmds[itr->position]; + + if (cmd == VG_CUBIC_TO_ABS) { + struct bezier bezier; + VGfloat bez[8]; + + bez[0] = itr->coords[itr->coord_position - 2]; + bez[1] = itr->coords[itr->coord_position - 1]; + bez[2] = itr->coords[itr->coord_position]; + bez[3] = itr->coords[itr->coord_position + 1]; + bez[4] = itr->coords[itr->coord_position + 2]; + bez[5] = itr->coords[itr->coord_position + 3]; + bez[6] = itr->coords[itr->coord_position + 4]; + bez[7] = itr->coords[itr->coord_position + 5]; + + bezier_init(&bezier, + bez[0], bez[1], + bez[2], bez[3], + bez[4], bez[5], + bez[6], bez[7]); + /* skip the first one, it's the same as the prev point */ + itr->curve_index = 1; + if (itr->curve_poly) { + polygon_destroy(itr->curve_poly); + itr->curve_poly = 0; + } + itr->curve_poly = bezier_to_polygon(&bezier); + } +} + +static VGboolean stroke_flat_has_next(struct stroke_iterator *itr) +{ + return (itr->curve_index >= 0 && + itr->curve_index < (polygon_vertex_count(itr->curve_poly)-1)) + || itr->position < (itr->num_commands - 1); +} + +static VGPathCommand stroke_flat_current_command(struct stroke_iterator *it) +{ + if (it->cmds[it->position] == VG_CUBIC_TO_ABS) { + return VG_LINE_TO_ABS; + } + return it->cmds[it->position]; +} + +static void stroke_flat_itr_coords(struct stroke_iterator *itr, VGfloat *coords) +{ + if (itr->curve_index <= -1 && itr->position >= itr->num_commands) + return; + + if (itr->curve_index >= 0) { + polygon_vertex(itr->curve_poly, itr->curve_index, + coords); + return; + } + + switch (stroke_itr_command(itr)) { + case VG_MOVE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_LINE_TO_ABS: + coords[0] = itr->coords[itr->coord_position]; + coords[1] = itr->coords[itr->coord_position + 1]; + break; + case VG_CUBIC_TO_ABS: + default: + debug_assert(!"invalid command!\n"); + } +} + +static void stroke_flat_iterator(struct stroke_iterator *itr, + struct array *cmds, + struct array *coords) +{ + stroke_itr_common_init(itr, cmds, coords); + itr->position = 0; + itr->coord_position = 0; + + itr->next = stroke_flat_next; + itr->has_next = stroke_flat_has_next; + itr->current_command = stroke_flat_current_command; + itr->current_coords = stroke_flat_itr_coords; + itr->curve_index = -1; + itr->curve_poly = 0; +} + + +static INLINE VGboolean finite_coords4(const VGfloat *c) +{ + return + isfinite(c[0]) && isfinite(c[1]) && + isfinite(c[2]) && isfinite(c[3]); +} + +/* from Graphics Gems II */ +#define SAME_SIGNS(a, b) ((a) * (b) >= 0) +static VGboolean do_lines_intersect(VGfloat x1, VGfloat y1, VGfloat x2, VGfloat y2, + VGfloat x3, VGfloat y3, VGfloat x4, VGfloat y4) +{ + VGfloat a1, a2, b1, b2, c1, c2; /* Coefficients of line eqns */ + VGfloat r1, r2, r3, r4; /* 'sign' values */ + + a1 = y2 - y1; + b1 = x1 - x2; + c1 = x2 * y1 - x1 * y2; + + r3 = a1 * x3 + b1 * y3 + c1; + r4 = a1 * x4 + b1 * y4 + c1; + + if (r3 != 0 && r4 != 0 && SAME_SIGNS(r3, r4)) + return VG_FALSE; + + a2 = y4 - y3; + b2 = x3 - x4; + c2 = x4 * y3 - x3 * y4; + + r1 = a2 * x1 + b2 * y1 + c2; + r2 = a2 * x2 + b2 * y2 + c2; + + if (r1 != 0 && r2 != 0 && SAME_SIGNS(r1, r2)) + return VG_FALSE; + + return VG_TRUE; +} + +static INLINE VGfloat line_dx(const VGfloat *l) +{ + return l[2] - l[0]; +} + +static INLINE VGfloat line_dy(const VGfloat *l) +{ + return l[3] - l[1]; +} + +static INLINE VGfloat line_angle(const VGfloat *l) +{ + const VGfloat dx = line_dx(l); + const VGfloat dy = line_dy(l); + + const VGfloat theta = atan2(-dy, dx) * 360.0 / M_2PI; + + const VGfloat theta_normalized = theta < 0 ? theta + 360 : theta; + + if (floatsEqual(theta_normalized, 360.f)) + return 0; + else + return theta_normalized; +} + +static INLINE void line_set_length(VGfloat *l, VGfloat len) +{ + VGfloat uv[] = {l[0], l[1], l[2], l[3]}; + if (null_line(l)) + return; + line_normalize(uv); + l[2] = l[0] + line_dx(uv) * len; + l[3] = l[1] + line_dy(uv) * len; +} + +static INLINE void line_translate(VGfloat *l, VGfloat x, VGfloat y) +{ + l[0] += x; + l[1] += y; + l[2] += x; + l[3] += y; +} + +static INLINE VGfloat line_angle_to(const VGfloat *l1, + const VGfloat *l2) +{ + VGfloat a1, a2, delta, delta_normalized; + if (null_line(l1) || null_line(l1)) + return 0; + + a1 = line_angle(l1); + a2 = line_angle(l2); + + delta = a2 - a1; + delta_normalized = delta < 0 ? delta + 360 : delta; + + if (floatsEqual(delta, 360.f)) + return 0; + else + return delta_normalized; +} + +static INLINE VGfloat line_angles(const VGfloat *l1, + const VGfloat *l2) +{ + VGfloat cos_line, rad = 0; + + if (null_line(l1) || null_line(l2)) + return 0; + + cos_line = (line_dx(l1)*line_dx(l2) + line_dy(l1)*line_dy(l2)) / + (line_lengthv(l1)*line_lengthv(l2)); + rad = 0; + + if (cos_line >= -1.0 && cos_line <= 1.0) + rad = acos(cos_line); + return rad * 360 / M_2PI; +} + + +static INLINE VGfloat adapted_angle_on_x(const VGfloat *line) +{ + const VGfloat identity[] = {0, 0, 1, 0}; + VGfloat angle = line_angles(line, identity); + if (line_dy(line) > 0) + angle = 360 - angle; + return angle; +} + +static enum intersection_type line_intersect(const VGfloat *l1, + const VGfloat *l2, + float *intersection_point) +{ + VGfloat isect[2]; + enum intersection_type type; + VGboolean dx_zero, ldx_zero; + + if (null_line(l1) || null_line(l2) || + !finite_coords4(l1) || !finite_coords4(l2)) + return NoIntersections; + + type = do_lines_intersect(l1[0], l1[1], l1[2], l1[3], l2[0], l2[1], l2[2], l2[3]) + ? BoundedIntersection : UnboundedIntersection; + + dx_zero = floatsEqual(line_dx(l1) + 1, 1); + ldx_zero = floatsEqual(line_dx(l2) + 1, 1); + + /* one of the lines is vertical */ + if (dx_zero && ldx_zero) { + type = NoIntersections; + } else if (dx_zero) { + VGfloat la = line_dy(l2) / line_dx(l2); + isect[0] = l1[0]; + isect[1] = la * l1[0] + l2[1] - la * l2[0]; + } else if (ldx_zero) { + VGfloat ta = line_dy(l1) / line_dx(l1); + isect[0] = l2[0]; + isect[1] = ta * l2[0] + l1[1] - ta*l1[0]; + } else { + VGfloat x; + VGfloat ta = line_dy(l1) / line_dx(l1); + VGfloat la = line_dy(l2) / line_dx(l2); + if (ta == la) + return NoIntersections; + + x = ( - l2[1] + la * l2[0] + l1[1] - ta * l1[0] ) / (la - ta); + isect[0] = x; + isect[1] = ta*(x - l1[0]) + l1[1]; + } + if (intersection_point) { + intersection_point[0] = isect[0]; + intersection_point[1] = isect[1]; + } + return type; +} + +static INLINE enum line_join_mode stroker_join_mode(struct stroker *s) +{ + switch(s->join_style) { + case VG_JOIN_MITER: + return MiterJoin; + case VG_JOIN_ROUND: + return RoundJoin; + case VG_JOIN_BEVEL: + return FlatJoin; + default: + return FlatJoin; + } +} + +static INLINE enum line_join_mode stroker_cap_mode(struct stroker *s) +{ + switch(s->cap_style) { + case VG_CAP_BUTT: + return FlatJoin; + case VG_CAP_ROUND: + return RoundCap; + case VG_CAP_SQUARE: + return SquareJoin; + default: + return FlatJoin; + } +} + +void stroker_emit_move_to(struct stroker *stroker, VGfloat x, VGfloat y) +{ + VGubyte cmds = VG_MOVE_TO_ABS; + VGfloat coords[2] = {x, y}; +#if DEBUG_EMITS + debug_printf("emit move %f, %f\n", x, y); +#endif + stroker->back2_x = stroker->back1_x; + stroker->back2_y = stroker->back1_y; + stroker->back1_x = x; + stroker->back1_y = y; + + path_append_data(stroker->path, + 1, + &cmds, &coords); +} + +void stroker_emit_line_to(struct stroker *stroker, VGfloat x, VGfloat y) +{ + VGubyte cmds = VG_LINE_TO_ABS; + VGfloat coords[2] = {x, y}; +#if DEBUG_EMITS + debug_printf("emit line %f, %f\n", x, y); +#endif + stroker->back2_x = stroker->back1_x; + stroker->back2_y = stroker->back1_y; + stroker->back1_x = x; + stroker->back1_y = y; + path_append_data(stroker->path, + 1, + &cmds, &coords); +} + +void stroker_emit_curve_to(struct stroker *stroker, VGfloat px1, VGfloat py1, + VGfloat px2, VGfloat py2, + VGfloat x, VGfloat y) +{ + VGubyte cmds = VG_CUBIC_TO_ABS; + VGfloat coords[6] = {px1, py1, px2, py2, x, y}; +#if DEBUG_EMITS + debug_printf("emit curve %f, %f, %f, %f, %f, %f\n", px1, py1, + px2, py2, x, y); +#endif + + if (px2 == x && py2 == y) { + if (px1 == x && py1 == y) { + stroker->back2_x = stroker->back1_x; + stroker->back2_y = stroker->back1_y; + } else { + stroker->back2_x = px1; + stroker->back2_y = py1; + } + } else { + stroker->back2_x = px2; + stroker->back2_y = py2; + } + stroker->back1_x = x; + stroker->back1_y = y; + + path_append_data(stroker->path, + 1, + &cmds, &coords); +} + +static INLINE void create_round_join(struct stroker *stroker, + VGfloat x1, VGfloat y1, + VGfloat x2, VGfloat y2, + VGfloat width, VGfloat height) +{ + struct arc arc; + struct matrix matrix; + + matrix_load_identity(&matrix); + + /*stroker_emit_line_to(stroker, nx, ny);*/ + + arc_init(&arc, VG_SCCWARC_TO_ABS, + x1, y1, x2, y2, width/2, height/2, 0); + arc_stroker_emit(&arc, stroker, &matrix); +} + + +static void create_joins(struct stroker *stroker, + VGfloat focal_x, VGfloat focal_y, + const VGfloat *next_line, enum line_join_mode join) +{ +#if DEBUG_EMITS + debug_printf("create_joins: focal=[%f, %f], next_line=[%f, %f,%f, %f]\n", + focal_x, focal_y, + next_line[0], next_line[1], next_line[2], next_line[3]); +#endif + /* if we're alredy connected do nothing */ + if (floatsEqual(stroker->back1_x, next_line[0]) && + floatsEqual(stroker->back1_y, next_line[1])) + return; + + if (join == FlatJoin) { + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + } else { + VGfloat prev_line[] = {stroker->back2_x, stroker->back2_y, + stroker->back1_x, stroker->back1_y}; + + VGfloat isect[2]; + enum intersection_type type = line_intersect(prev_line, next_line, isect); + + if (join == SquareJoin) { + VGfloat offset = stroker->stroke_width / 2; + VGfloat l1[4] = {prev_line[0], + prev_line[1], + prev_line[2], + prev_line[3]}; + VGfloat l2[4] = {next_line[2], + next_line[3], + next_line[0], + next_line[1]}; + + line_translate(l1, line_dx(l1), line_dy(l1)); + line_set_length(l1, offset); + + line_translate(l2, line_dx(l2), line_dy(l2)); + line_set_length(l2, offset); + + stroker_emit_line_to(stroker, l1[2], l1[3]); + stroker_emit_line_to(stroker, l2[2], l2[3]); + stroker_emit_line_to(stroker, l2[0], l2[1]); + } else if (join == RoundJoin) { + VGfloat offset = stroker->stroke_width / 2; + VGfloat short_cut[4] = {prev_line[2], prev_line[3], + next_line[0], next_line[1]}; + VGfloat angle = line_angles(prev_line, short_cut); + + if (type == BoundedIntersection || + (angle > 90 && !floatsEqual(angle, 90.f))) { + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + return; + } + create_round_join(stroker, prev_line[2], prev_line[3], + next_line[0], next_line[1], + offset * 2, offset * 2); + + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + } else if (join == RoundCap) { + VGfloat offset = stroker->stroke_width / 2; + VGfloat l1[4] = { prev_line[0], prev_line[1], + prev_line[2], prev_line[3] }; + VGfloat l2[4] = {focal_x, focal_y, + prev_line[2], prev_line[3]}; + + line_translate(l1, line_dx(l1), line_dy(l1)); + line_set_length(l1, KAPPA * offset); + + /* normal between prev_line and focal */ + line_translate(l2, -line_dy(l2), line_dx(l2)); + line_set_length(l2, KAPPA * offset); + + stroker_emit_curve_to(stroker, l1[2], l1[3], + l2[2], l2[3], + l2[0], l2[1]); + + l2[0] = l2[0]; + l2[1] = l2[1]; + l2[2] = l2[0] - line_dx(l2); + l2[3] = l2[1] - line_dy(l2); + + line_translate(l1, next_line[0] - l1[0], next_line[1] - l1[1]); + + stroker_emit_curve_to(stroker, + l2[2], l2[3], + l1[2], l1[3], + l1[0], l1[1]); + } else if (join == MiterJoin) { + VGfloat miter_line[4] = {stroker->back1_x, stroker->back1_y, + isect[0], isect[1]}; + VGfloat sl = (stroker->stroke_width * stroker->miter_limit); + VGfloat inside_line[4] = {prev_line[2], prev_line[3], + next_line[0], next_line[1]}; + VGfloat angle = line_angle_to(inside_line, prev_line); + + if (type == BoundedIntersection || + (angle > 90 && !floatsEqual(angle, 90.f))) { + /* + debug_printf("f = %f, nl = %f, pl = %f, is = %f\n", + focal_x, next_line[0], + prev_line[2], isect[0]);*/ + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + return; + } + + if (type == NoIntersections || line_lengthv(miter_line) > sl) { + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + } else { + stroker_emit_line_to(stroker, isect[0], isect[1]); + stroker_emit_line_to(stroker, next_line[0], next_line[1]); + } + } else { + debug_assert(!"create_joins bad join style"); + } + } +} + +static void stroker_add_segment(struct stroker *stroker, + VGPathCommand cmd, + const VGfloat *coords, + VGint num_coords) +{ + /* skip duplicated points */ + if (stroker->segments->num_elements && + stroker->last_cmd == cmd) { + VGfloat *data = stroker->control_points->data; + data += stroker->control_points->num_elements; + data -= num_coords; + switch (cmd) { + case VG_MOVE_TO_ABS: + if (floatsEqual(coords[0], data[0]) && + floatsEqual(coords[1], data[1])) + return; + break; + case VG_LINE_TO_ABS: + if (floatsEqual(coords[0], data[0]) && + floatsEqual(coords[1], data[1])) + return; + break; + case VG_CUBIC_TO_ABS: + if (floatsEqual(coords[0], data[0]) && + floatsEqual(coords[1], data[1]) && + floatsEqual(coords[2], data[2]) && + floatsEqual(coords[3], data[3]) && + floatsEqual(coords[4], data[4]) && + floatsEqual(coords[5], data[5])) + return; + break; + default: + debug_assert(!"Invalid stroke segment"); + } + } else if (stroker->last_cmd == VG_CUBIC_TO_ABS && + cmd == VG_LINE_TO_ABS) { + VGfloat *data = stroker->control_points->data; + data += stroker->control_points->num_elements; + data -= 2; + if (floatsEqual(coords[0], data[0]) && + floatsEqual(coords[1], data[1])) + return; + } + stroker->last_cmd = cmd; + array_append_data(stroker->segments, &cmd, 1); + array_append_data(stroker->control_points, coords, num_coords); +} + +void stroker_move_to(struct stroker *stroker, VGfloat x, VGfloat y) +{ + VGfloat coords[2] = {x, y}; +#if STROKE_SEGMENTS + debug_printf("stroker_move_to(%f, %f)\n", x, y); +#endif + + if (stroker->segments->num_elements > 0) + stroker->process_subpath(stroker); + + array_reset(stroker->segments); + array_reset(stroker->control_points); + + stroker_add_segment(stroker, VG_MOVE_TO_ABS, coords, 2); +} + +void stroker_line_to(struct stroker *stroker, VGfloat x, VGfloat y) +{ + VGfloat coords[] = {x, y}; + +#if STROKE_SEGMENTS + debug_printf("stroker_line_to(%f, %f)\n", x, y); +#endif + if (!stroker->segments->num_elements) + stroker_add_segment(stroker, VG_MOVE_TO_ABS, zero_coords, 2); + + stroker_add_segment(stroker, VG_LINE_TO_ABS, coords, 2); +} + +void stroker_curve_to(struct stroker *stroker, VGfloat px1, VGfloat py1, + VGfloat px2, VGfloat py2, + VGfloat x, VGfloat y) +{ + VGfloat coords[] = {px1, py1, + px2, py2, + x, y}; +#if STROKE_SEGMENTS + debug_printf("stroker_curve_to(%f, %f, %f, %f, %f, %f)\n", + px1, py1, px2, py2, x, y); +#endif + if (!stroker->segments->num_elements) + stroker_add_segment(stroker, VG_MOVE_TO_ABS, zero_coords, 2); + + stroker_add_segment(stroker, VG_CUBIC_TO_ABS, coords, 6); +} + +static INLINE VGboolean is_segment_null(VGPathCommand cmd, + VGfloat *coords, + VGfloat *res) +{ + switch(cmd) { + case VG_MOVE_TO_ABS: + case VG_LINE_TO_ABS: + return floatsEqual(coords[0], res[0]) && + floatsEqual(coords[1], res[1]); + break; + case VG_CUBIC_TO_ABS: + return floatsEqual(coords[0], res[0]) && + floatsEqual(coords[1], res[1]) && + floatsEqual(coords[2], res[0]) && + floatsEqual(coords[3], res[1]) && + floatsEqual(coords[4], res[0]) && + floatsEqual(coords[5], res[1]); + break; + default: + assert(0); + } + return VG_FALSE; +} + +static VGboolean vg_stroke_outline(struct stroke_iterator *it, + struct stroker *stroker, + VGboolean cap_first, + VGfloat *start_tangent) +{ + const int MAX_OFFSET = 16; + struct bezier offset_curves[MAX_OFFSET]; + VGPathCommand first_element; + VGfloat start[2], prev[2]; + VGboolean first = VG_TRUE; + VGfloat offset; + + first_element = stroke_itr_command(it); + if (first_element != VG_MOVE_TO_ABS) { + stroker_emit_move_to(stroker, 0.f, 0.f); + prev[0] = 0.f; + prev[1] = 0.f; + } + stroke_itr_coords(it, start); +#if STROKE_DEBUG + debug_printf(" -> (side) [%.2f, %.2f]\n", + start[0], + start[1]); +#endif + + prev[0] = start[0]; + prev[1] = start[1]; + + offset = stroker->stroke_width / 2; + + if (!it->has_next(it)) { + /* single point */ + + return VG_TRUE; + } + + while (it->has_next(it)) { + VGPathCommand cmd; + VGfloat coords[8]; + + it->next(it); + cmd = stroke_itr_command(it); + stroke_itr_coords(it, coords); + + if (cmd == VG_LINE_TO_ABS) { + VGfloat line[4] = {prev[0], prev[1], coords[0], coords[1]}; + VGfloat normal[4]; + line_normal(line, normal); + +#if STROKE_DEBUG + debug_printf("\n ---> (side) lineto [%.2f, %.2f]\n", coords[0], coords[1]); +#endif + line_set_length(normal, offset); + line_translate(line, line_dx(normal), line_dy(normal)); + + /* if we are starting a new subpath, move to correct starting point */ + if (first) { + if (cap_first) + create_joins(stroker, prev[0], prev[1], line, + stroker_cap_mode(stroker)); + else + stroker_emit_move_to(stroker, line[0], line[1]); + memcpy(start_tangent, line, + sizeof(VGfloat) * 4); + first = VG_FALSE; + } else { + create_joins(stroker, prev[0], prev[1], line, + stroker_join_mode(stroker)); + } + + /* add the stroke for this line */ + stroker_emit_line_to(stroker, line[2], line[3]); + prev[0] = coords[0]; + prev[1] = coords[1]; + } else if (cmd == VG_CUBIC_TO_ABS) { +#if STROKE_DEBUG + debug_printf("\n ---> (side) cubicTo [%.2f, %.2f]\n", + coords[4], + coords[5]); +#endif + struct bezier bezier; + int count; + + bezier_init(&bezier, + prev[0], prev[1], coords[0], coords[1], + coords[2], coords[3], coords[4], coords[5]); + + count = bezier_translate_by_normal(&bezier, + offset_curves, + MAX_OFFSET, + offset, + curve_threshold); + + if (count) { + /* if we are starting a new subpath, move to correct starting point */ + VGfloat tangent[4]; + VGint i; + + bezier_start_tangent(&bezier, tangent); + line_translate(tangent, + offset_curves[0].x1 - bezier.x1, + offset_curves[0].y1 - bezier.y1); + if (first) { + VGfloat pt[2] = {offset_curves[0].x1, + offset_curves[0].y1}; + + if (cap_first) { + create_joins(stroker, prev[0], prev[1], tangent, + stroker_cap_mode(stroker)); + } else { + stroker_emit_move_to(stroker, pt[0], pt[1]); + } + start_tangent[0] = tangent[0]; + start_tangent[1] = tangent[1]; + start_tangent[2] = tangent[2]; + start_tangent[3] = tangent[3]; + first = VG_FALSE; + } else { + create_joins(stroker, prev[0], prev[1], tangent, + stroker_join_mode(stroker)); + } + + /* add these beziers */ + for (i = 0; i < count; ++i) { + struct bezier *bez = &offset_curves[i]; + stroker_emit_curve_to(stroker, + bez->x2, bez->y2, + bez->x3, bez->y3, + bez->x4, bez->y4); + } + } + + prev[0] = coords[4]; + prev[1] = coords[5]; + } + } + + if (floatsEqual(start[0], prev[0]) && + floatsEqual(start[1], prev[1])) { + /* closed subpath, join first and last point */ +#if STROKE_DEBUG + debug_printf("\n stroker: closed subpath\n"); +#endif + create_joins(stroker, prev[0], prev[1], start_tangent, + stroker_join_mode(stroker)); + return VG_TRUE; + } else { +#if STROKE_DEBUG + debug_printf("\n stroker: open subpath\n"); +#endif + return VG_FALSE; + } +} + +static void stroker_process_subpath(struct stroker *stroker) +{ + VGboolean fwclosed, bwclosed; + VGfloat fw_start_tangent[4], bw_start_tangent[4]; + struct stroke_iterator fwit; + struct stroke_iterator bwit; + debug_assert(stroker->segments->num_elements > 0); + + memset(fw_start_tangent, 0, + sizeof(VGfloat)*4); + memset(bw_start_tangent, 0, + sizeof(VGfloat)*4); + + stroke_forward_iterator(&fwit, stroker->segments, + stroker->control_points); + stroke_backward_iterator(&bwit, stroker->segments, + stroker->control_points); + + debug_assert(fwit.cmds[0] == VG_MOVE_TO_ABS); + + fwclosed = vg_stroke_outline(&fwit, stroker, VG_FALSE, fw_start_tangent); + bwclosed = vg_stroke_outline(&bwit, stroker, !fwclosed, bw_start_tangent); + + if (!bwclosed) + create_joins(stroker, + fwit.coords[0], fwit.coords[1], fw_start_tangent, + stroker_cap_mode(stroker)); + else { + /* hack to handle the requirement of the VG spec that says that strokes + * of len==0 that have butt cap or round cap still need + * to be rendered. (8.7.4 Stroke Generation) */ + if (stroker->segments->num_elements <= 3) { + VGPathCommand cmd; + VGfloat data[8], coords[8]; + struct stroke_iterator *it = &fwit; + + stroke_forward_iterator(it, stroker->segments, + stroker->control_points); + cmd = stroke_itr_command(it); + stroke_itr_coords(it, coords); + if (cmd != VG_MOVE_TO_ABS) { + memset(data, 0, sizeof(VGfloat) * 8); + if (!is_segment_null(cmd, coords, data)) + return; + } else { + data[0] = coords[0]; + data[1] = coords[1]; + } + while (it->has_next(it)) { + it->next(it); + cmd = stroke_itr_command(it); + stroke_itr_coords(it, coords); + if (!is_segment_null(cmd, coords, data)) + return; + } + /* generate the square/round cap */ + if (stroker->cap_style == VG_CAP_SQUARE) { + VGfloat offset = stroker->stroke_width / 2; + stroker_emit_move_to(stroker, data[0] - offset, + data[1] - offset); + stroker_emit_line_to(stroker, data[0] + offset, + data[1] - offset); + stroker_emit_line_to(stroker, data[0] + offset, + data[1] + offset); + stroker_emit_line_to(stroker, data[0] - offset, + data[1] + offset); + stroker_emit_line_to(stroker, data[0] - offset, + data[1] - offset); + } else if (stroker->cap_style == VG_CAP_ROUND) { + VGfloat offset = stroker->stroke_width / 2; + VGfloat cx = data[0], cy = data[1]; + { /*circle */ + struct arc arc; + struct matrix matrix; + matrix_load_identity(&matrix); + + stroker_emit_move_to(stroker, cx + offset, cy); + arc_init(&arc, VG_SCCWARC_TO_ABS, + cx + offset, cy, + cx - offset, cy, + offset, offset, 0); + arc_stroker_emit(&arc, stroker, &matrix); + arc_init(&arc, VG_SCCWARC_TO_ABS, + cx - offset, cy, + cx + offset, cy, + offset, offset, 0); + arc_stroker_emit(&arc, stroker, &matrix); + } + } + } + } +} + +static INLINE VGfloat dash_pattern(struct dash_stroker *stroker, + VGint idx) +{ + if (stroker->dash_pattern[idx] < 0) + return 0.f; + return stroker->dash_pattern[idx]; +} + +static void dash_stroker_process_subpath(struct stroker *str) +{ + struct dash_stroker *stroker = (struct dash_stroker *)str; + VGfloat sum_length = 0; + VGint i; + VGint idash = 0; + VGfloat pos = 0; + VGfloat elen = 0; + VGfloat doffset = stroker->dash_phase; + VGfloat estart = 0; + VGfloat estop = 0; + VGfloat cline[4]; + struct stroke_iterator it; + VGfloat prev[2]; + VGfloat move_to_pos[2]; + VGfloat line_to_pos[2]; + + VGboolean has_move_to = VG_FALSE; + + stroke_flat_iterator(&it, stroker->base.segments, + stroker->base.control_points); + + stroke_itr_coords(&it, prev); + move_to_pos[0] = prev[0]; + move_to_pos[1] = prev[1]; + + debug_assert(stroker->dash_pattern_num > 0); + + for (i = 0; i < stroker->dash_pattern_num; ++i) { + sum_length += dash_pattern(stroker, i); + } + + if (floatIsZero(sum_length)) { + return; + } + + doffset -= floorf(doffset / sum_length) * sum_length; + + while (!floatIsZero(doffset) && doffset >= dash_pattern(stroker, idash)) { + doffset -= dash_pattern(stroker, idash); + idash = (idash + 1) % stroker->dash_pattern_num; + } + + while (it.has_next(&it)) { + VGPathCommand cmd; + VGfloat coords[8]; + VGboolean done; + + it.next(&it); + cmd = stroke_itr_command(&it); + stroke_itr_coords(&it, coords); + + debug_assert(cmd == VG_LINE_TO_ABS); + cline[0] = prev[0]; + cline[1] = prev[1]; + cline[2] = coords[0]; + cline[3] = coords[1]; + + elen = line_lengthv(cline); + + estop = estart + elen; + + done = pos >= estop; + while (!done) { + VGfloat p2[2]; + + VGint idash_incr = 0; + VGboolean has_offset = doffset > 0; + VGfloat dpos = pos + dash_pattern(stroker, idash) - doffset - estart; + + debug_assert(dpos >= 0); + + if (dpos > elen) { /* dash extends this line */ + doffset = dash_pattern(stroker, idash) - (dpos - elen); + pos = estop; + done = VG_TRUE; + p2[0] = cline[2]; + p2[1] = cline[3]; + } else { /* Dash is on this line */ + line_point_at(cline, dpos/elen, p2); + pos = dpos + estart; + done = pos >= estop; + idash_incr = 1; + doffset = 0; + } + + if (idash % 2 == 0) { + line_to_pos[0] = p2[0]; + line_to_pos[1] = p2[1]; + + if (!has_offset || !has_move_to) { + stroker_move_to(&stroker->stroker, move_to_pos[0], move_to_pos[1]); + has_move_to = VG_TRUE; + } + stroker_line_to(&stroker->stroker, line_to_pos[0], line_to_pos[1]); + } else { + move_to_pos[0] = p2[0]; + move_to_pos[1] = p2[1]; + } + + idash = (idash + idash_incr) % stroker->dash_pattern_num; + } + + estart = estop; + prev[0] = coords[0]; + prev[1] = coords[1]; + } + + if (it.curve_poly) { + polygon_destroy(it.curve_poly); + it.curve_poly = 0; + } + + stroker->base.path = stroker->stroker.path; +} + +static void default_begin(struct stroker *stroker) +{ + array_reset(stroker->segments); + array_reset(stroker->control_points); +} + +static void default_end(struct stroker *stroker) +{ + if (stroker->segments->num_elements > 0) + stroker->process_subpath(stroker); +} + + +static void dash_stroker_begin(struct stroker *stroker) +{ + struct dash_stroker *dasher = + (struct dash_stroker *)stroker; + + default_begin(&dasher->stroker); + default_begin(stroker); +} + +static void dash_stroker_end(struct stroker *stroker) +{ + struct dash_stroker *dasher = + (struct dash_stroker *)stroker; + + default_end(stroker); + default_end(&dasher->stroker); +} + +void stroker_init(struct stroker *stroker, + struct vg_state *state) +{ + stroker->stroke_width = state->stroke.line_width.f; + stroker->miter_limit = state->stroke.miter_limit.f; + stroker->cap_style = state->stroke.cap_style; + stroker->join_style = state->stroke.join_style; + + stroker->begin = default_begin; + stroker->process_subpath = stroker_process_subpath; + stroker->end = default_end; + + stroker->segments = array_create(sizeof(VGubyte)); + stroker->control_points = array_create(sizeof(VGfloat)); + + stroker->back1_x = 0; + stroker->back1_y = 0; + stroker->back2_x = 0; + stroker->back2_y = 0; + + stroker->path = path_create(VG_PATH_DATATYPE_F, 1.0f, 0.0f, + 0, 0, VG_PATH_CAPABILITY_ALL); + + stroker->last_cmd = VG_CLOSE_PATH; +} + +void dash_stroker_init(struct stroker *str, + struct vg_state *state) +{ + struct dash_stroker *stroker = (struct dash_stroker *)str; + int i; + + stroker_init(str, state); + stroker_init(&stroker->stroker, state); + + { + int real_num = state->stroke.dash_pattern_num; + if (real_num % 2)/* if odd, ignore the last one */ + --real_num; + for (i = 0; i < real_num; ++i) + stroker->dash_pattern[i] = state->stroke.dash_pattern[i].f; + stroker->dash_pattern_num = real_num; + } + + stroker->dash_phase = state->stroke.dash_phase.f; + stroker->dash_phase_reset = state->stroke.dash_phase_reset; + + stroker->base.begin = dash_stroker_begin; + stroker->base.process_subpath = dash_stroker_process_subpath; + stroker->base.end = dash_stroker_end; + path_destroy(stroker->base.path); + stroker->base.path = NULL; +} + +void stroker_begin(struct stroker *stroker) +{ + stroker->begin(stroker); +} + +void stroker_end(struct stroker *stroker) +{ + stroker->end(stroker); +} + +void stroker_cleanup(struct stroker *stroker) +{ + array_destroy(stroker->segments); + array_destroy(stroker->control_points); +} + +void dash_stroker_cleanup(struct dash_stroker *stroker) +{ + /* if stroker->base.path is null means we never + * processed a valid path so delete the temp one + * we already created */ + if (!stroker->base.path) + path_destroy(stroker->stroker.path); + stroker_cleanup(&stroker->stroker); + stroker_cleanup((struct stroker*)stroker); +} diff --git a/src/gallium/state_trackers/vega/stroker.h b/src/gallium/state_trackers/vega/stroker.h new file mode 100644 index 0000000000..36543cd923 --- /dev/null +++ b/src/gallium/state_trackers/vega/stroker.h @@ -0,0 +1,89 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef STROKER_H +#define STROKER_H + +#include "VG/openvg.h" +#include "api_consts.h" + +struct path; +struct vg_state; +struct array; + +struct stroker { + void (*begin)(struct stroker *stroker); + void (*process_subpath)(struct stroker *stroker); + void (*end)(struct stroker *stroker); + + struct array *segments; + struct array *control_points; + struct path *path; + + VGfloat back1_x, back1_y; + VGfloat back2_x, back2_y; + + VGfloat stroke_width; + VGfloat miter_limit; + VGCapStyle cap_style; + VGJoinStyle join_style; + + VGPathCommand last_cmd; +}; + +struct dash_stroker { + struct stroker base; + + struct stroker stroker; + + VGfloat dash_pattern[VEGA_MAX_DASH_COUNT]; + VGint dash_pattern_num; + VGfloat dash_phase; + VGboolean dash_phase_reset; +}; + +void stroker_init(struct stroker *stroker, + struct vg_state *state); +void dash_stroker_init(struct stroker *stroker, + struct vg_state *state); +void dash_stroker_cleanup(struct dash_stroker *stroker); +void stroker_cleanup(struct stroker *stroker); + +void stroker_begin(struct stroker *stroker); +void stroker_move_to(struct stroker *stroker, VGfloat x, VGfloat y); +void stroker_line_to(struct stroker *stroker, VGfloat x, VGfloat y); +void stroker_curve_to(struct stroker *stroker, VGfloat px1, VGfloat py1, + VGfloat px2, VGfloat py2, + VGfloat x, VGfloat y); +void stroker_end(struct stroker *stroker); + +void stroker_emit_move_to(struct stroker *stroker, VGfloat x, VGfloat y); +void stroker_emit_line_to(struct stroker *stroker, VGfloat x, VGfloat y); +void stroker_emit_curve_to(struct stroker *stroker, VGfloat px1, VGfloat py1, + VGfloat px2, VGfloat py2, + VGfloat x, VGfloat y); + +#endif diff --git a/src/gallium/state_trackers/vega/util_array.h b/src/gallium/state_trackers/vega/util_array.h new file mode 100644 index 0000000000..4343dfe36e --- /dev/null +++ b/src/gallium/state_trackers/vega/util_array.h @@ -0,0 +1,122 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef UTIL_ARRAY_H +#define UTIL_ARRAY_H + +#include "util/u_memory.h" + +#define DEFAULT_ARRAY_SIZE 256 + +struct array { + VGint datatype_size; + void *data; + VGint size; + VGint num_elements; +}; + +static INLINE struct array *array_create(VGint datatype_size) +{ + struct array *array = CALLOC_STRUCT(array); + array->datatype_size = datatype_size; + + array->size = DEFAULT_ARRAY_SIZE; + array->data = malloc(array->size * array->datatype_size); + + return array; +} + + +static INLINE struct array *array_create_size(VGint datatype_size, VGint size) +{ + struct array *array = CALLOC_STRUCT(array); + array->datatype_size = datatype_size; + + array->size = size; + array->data = malloc(array->size * array->datatype_size); + + return array; +} + +static INLINE void array_destroy(struct array *array) +{ + if (array) + free(array->data); + free(array); +} + +static INLINE void array_resize(struct array *array, int num) +{ + VGint size = array->datatype_size * num; + void *data = malloc(size); + memcpy(data, array->data, array->size * array->datatype_size); + free(array->data); + array->data = data; + array->size = num; + array->num_elements = (array->num_elements > num) ? num : + array->num_elements; +} + +static INLINE void array_append_data(struct array *array, + const void *data, int num_elements) +{ + VGbyte *adata; + + while (array->num_elements + num_elements > array->size) { + array_resize(array, (array->num_elements + num_elements) * 1.5); + } + adata = (VGbyte *)array->data; + memcpy(adata + (array->num_elements * array->datatype_size), data, + num_elements * array->datatype_size); + array->num_elements += num_elements; +} + +static INLINE void array_change_data(struct array *array, + const void *data, + int start_idx, + int num_elements) +{ + VGbyte *adata = (VGbyte *)array->data; + memcpy(adata + (start_idx * array->datatype_size), data, + num_elements * array->datatype_size); +} + +static INLINE void array_remove_element(struct array *array, + int idx) +{ + VGbyte *adata = (VGbyte *)array->data; + memmove(adata + (idx * array->datatype_size), + adata + ((idx + 1) * array->datatype_size), + (array->num_elements - idx - 1) * array->datatype_size); + --array->num_elements; +} + +static INLINE void array_reset(struct array *array) +{ + array->num_elements = 0; +} + +#endif diff --git a/src/gallium/state_trackers/vega/vg_context.c b/src/gallium/state_trackers/vega/vg_context.c new file mode 100644 index 0000000000..e0ff02f3a9 --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_context.c @@ -0,0 +1,543 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "vg_context.h" + +#include "paint.h" +#include "renderer.h" +#include "shaders_cache.h" +#include "shader.h" +#include "asm_util.h" +#include "st_inlines.h" + +#include "pipe/p_context.h" +#include "pipe/p_inlines.h" +#include "pipe/p_shader_tokens.h" + +#include "cso_cache/cso_context.h" + +#include "util/u_simple_shaders.h" +#include "util/u_memory.h" +#include "util/u_blit.h" + +struct vg_context *_vg_context = 0; + +struct vg_context * vg_current_context(void) +{ + return _vg_context; +} + +static void init_clear(struct vg_context *st) +{ + struct pipe_context *pipe = st->pipe; + + /* rasterizer state: bypass clipping */ + memset(&st->clear.raster, 0, sizeof(st->clear.raster)); + st->clear.raster.gl_rasterization_rules = 1; + + /* fragment shader state: color pass-through program */ + st->clear.fs = + util_make_fragment_passthrough_shader(pipe); +} +void vg_set_current_context(struct vg_context *ctx) +{ + _vg_context = ctx; +} + +struct vg_context * vg_create_context(struct pipe_context *pipe, + const void *visual, + struct vg_context *share) +{ + struct vg_context *ctx; + + ctx = CALLOC_STRUCT(vg_context); + + ctx->pipe = pipe; + + vg_init_state(&ctx->state.vg); + ctx->state.dirty = ALL_DIRTY; + + ctx->cso_context = cso_create_context(pipe); + + init_clear(ctx); + + ctx->default_paint = paint_create(ctx); + ctx->state.vg.stroke_paint = ctx->default_paint; + ctx->state.vg.fill_paint = ctx->default_paint; + + + ctx->mask.sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + ctx->mask.sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + ctx->mask.sampler.min_mip_filter = PIPE_TEX_MIPFILTER_NONE; + ctx->mask.sampler.min_img_filter = PIPE_TEX_FILTER_NEAREST; + ctx->mask.sampler.mag_img_filter = PIPE_TEX_FILTER_NEAREST; + ctx->mask.sampler.normalized_coords = 0; + + ctx->blend_sampler.wrap_s = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + ctx->blend_sampler.wrap_t = PIPE_TEX_WRAP_CLAMP_TO_EDGE; + ctx->blend_sampler.min_mip_filter = PIPE_TEX_MIPFILTER_NONE; + ctx->blend_sampler.min_img_filter = PIPE_TEX_FILTER_NEAREST; + ctx->blend_sampler.mag_img_filter = PIPE_TEX_FILTER_NEAREST; + ctx->blend_sampler.normalized_coords = 0; + + vg_set_error(ctx, VG_NO_ERROR); + + ctx->owned_objects[VG_OBJECT_PAINT] = cso_hash_create(); + ctx->owned_objects[VG_OBJECT_IMAGE] = cso_hash_create(); + ctx->owned_objects[VG_OBJECT_MASK] = cso_hash_create(); + ctx->owned_objects[VG_OBJECT_FONT] = cso_hash_create(); + ctx->owned_objects[VG_OBJECT_PATH] = cso_hash_create(); + + ctx->renderer = renderer_create(ctx); + ctx->sc = shaders_cache_create(ctx); + ctx->shader = shader_create(ctx); + + ctx->blit = util_create_blit(ctx->pipe, ctx->cso_context); + + return ctx; +} + +void vg_destroy_context(struct vg_context *ctx) +{ + struct pipe_constant_buffer *cbuf = &ctx->mask.cbuf; + struct pipe_constant_buffer *vsbuf = &ctx->vs_const_buffer; + + util_destroy_blit(ctx->blit); + renderer_destroy(ctx->renderer); + shaders_cache_destroy(ctx->sc); + shader_destroy(ctx->shader); + paint_destroy(ctx->default_paint); + + if (cbuf && cbuf->buffer) + pipe_buffer_reference(&cbuf->buffer, NULL); + + if (vsbuf && vsbuf->buffer) + pipe_buffer_reference(&vsbuf->buffer, NULL); + + if (ctx->clear.fs) { + cso_delete_fragment_shader(ctx->cso_context, ctx->clear.fs); + ctx->clear.fs = NULL; + } + + if (ctx->plain_vs) { + vg_shader_destroy(ctx, ctx->plain_vs); + ctx->plain_vs = NULL; + } + if (ctx->clear_vs) { + vg_shader_destroy(ctx, ctx->clear_vs); + ctx->clear_vs = NULL; + } + if (ctx->texture_vs) { + vg_shader_destroy(ctx, ctx->texture_vs); + ctx->texture_vs = NULL; + } + + if (ctx->pass_through_depth_fs) + vg_shader_destroy(ctx, ctx->pass_through_depth_fs); + if (ctx->mask.union_fs) + vg_shader_destroy(ctx, ctx->mask.union_fs); + if (ctx->mask.intersect_fs) + vg_shader_destroy(ctx, ctx->mask.intersect_fs); + if (ctx->mask.subtract_fs) + vg_shader_destroy(ctx, ctx->mask.subtract_fs); + if (ctx->mask.set_fs) + vg_shader_destroy(ctx, ctx->mask.set_fs); + + cso_release_all(ctx->cso_context); + cso_destroy_context(ctx->cso_context); + + cso_hash_delete(ctx->owned_objects[VG_OBJECT_PAINT]); + cso_hash_delete(ctx->owned_objects[VG_OBJECT_IMAGE]); + cso_hash_delete(ctx->owned_objects[VG_OBJECT_MASK]); + cso_hash_delete(ctx->owned_objects[VG_OBJECT_FONT]); + cso_hash_delete(ctx->owned_objects[VG_OBJECT_PATH]); + + free(ctx); +} + +void vg_init_object(struct vg_object *obj, struct vg_context *ctx, enum vg_object_type type) +{ + obj->type = type; + obj->ctx = ctx; +} + +VGboolean vg_context_is_object_valid(struct vg_context *ctx, + enum vg_object_type type, + void *ptr) +{ + if (ctx) { + struct cso_hash *hash = ctx->owned_objects[type]; + if (!hash) + return VG_FALSE; + return cso_hash_contains(hash, (unsigned)(long)ptr); + } + return VG_FALSE; +} + +void vg_context_add_object(struct vg_context *ctx, + enum vg_object_type type, + void *ptr) +{ + if (ctx) { + struct cso_hash *hash = ctx->owned_objects[type]; + if (!hash) + return; + cso_hash_insert(hash, (unsigned)(long)ptr, ptr); + } +} + +void vg_context_remove_object(struct vg_context *ctx, + enum vg_object_type type, + void *ptr) +{ + if (ctx) { + struct cso_hash *hash = ctx->owned_objects[type]; + if (!hash) + return; + cso_hash_take(hash, (unsigned)(long)ptr); + } +} + +static void update_clip_state(struct vg_context *ctx) +{ + struct pipe_depth_stencil_alpha_state *dsa = &ctx->state.g3d.dsa; + struct vg_state *state = &ctx->state.vg; + + memset(dsa, 0, sizeof(struct pipe_depth_stencil_alpha_state)); + + if (state->scissoring) { + struct pipe_blend_state *blend = &ctx->state.g3d.blend; + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + dsa->depth.writemask = 1;/*glDepthMask(TRUE);*/ + dsa->depth.func = PIPE_FUNC_ALWAYS; + dsa->depth.enabled = 1; + + cso_save_blend(ctx->cso_context); + cso_save_fragment_shader(ctx->cso_context); + /* set a passthrough shader */ + if (!ctx->pass_through_depth_fs) + ctx->pass_through_depth_fs = shader_create_from_text(ctx->pipe, + pass_through_depth_asm, + 40, + PIPE_SHADER_FRAGMENT); + cso_set_fragment_shader_handle(ctx->cso_context, + ctx->pass_through_depth_fs->driver); + cso_set_depth_stencil_alpha(ctx->cso_context, dsa); + + ctx->pipe->clear(ctx->pipe, PIPE_CLEAR_DEPTHSTENCIL, NULL, 1.0, 0); + + /* disable color writes */ + blend->colormask = 0; /*disable colorwrites*/ + cso_set_blend(ctx->cso_context, blend); + + /* enable scissoring */ + for (int i = 0; i < state->scissor_rects_num; ++i) { + const float x = state->scissor_rects[i * 4 + 0].f; + const float y = state->scissor_rects[i * 4 + 1].f; + const float width = state->scissor_rects[i * 4 + 2].f; + const float height = state->scissor_rects[i * 4 + 3].f; + VGfloat minx, miny, maxx, maxy; + + minx = 0; + miny = 0; + maxx = fb->width; + maxy = fb->height; + + if (x > minx) + minx = x; + if (y > miny) + miny = y; + + if (x + width < maxx) + maxx = x + width; + if (y + height < maxy) + maxy = y + height; + + /* check for null space */ + if (minx >= maxx || miny >= maxy) + minx = miny = maxx = maxy = 0; + + /*glClear(GL_DEPTH_BUFFER_BIT);*/ + renderer_draw_quad(ctx->renderer, minx, miny, maxx, maxy, 0.0f); + } + + blend->colormask = 1; /*enable colorwrites*/ + cso_restore_blend(ctx->cso_context); + cso_restore_fragment_shader(ctx->cso_context); + + dsa->depth.enabled = 1; /* glEnable(GL_DEPTH_TEST); */ + dsa->depth.writemask = 0;/*glDepthMask(FALSE);*/ + dsa->depth.func = PIPE_FUNC_GEQUAL; + } +} + +void vg_validate_state(struct vg_context *ctx) +{ + if ((ctx->state.dirty & BLEND_DIRTY)) { + struct pipe_blend_state *blend = &ctx->state.g3d.blend; + memset(blend, 0, sizeof(struct pipe_blend_state)); + blend->blend_enable = 1; + blend->colormask |= PIPE_MASK_R; + blend->colormask |= PIPE_MASK_G; + blend->colormask |= PIPE_MASK_B; + blend->colormask |= PIPE_MASK_A; + + switch (ctx->state.vg.blend_mode) { + case VG_BLEND_SRC: + blend->rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + break; + case VG_BLEND_SRC_OVER: + blend->rgb_src_factor = PIPE_BLENDFACTOR_SRC_ALPHA; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_INV_SRC_ALPHA; + break; + case VG_BLEND_DST_OVER: + blend->rgb_src_factor = PIPE_BLENDFACTOR_INV_DST_ALPHA; + blend->alpha_src_factor = PIPE_BLENDFACTOR_INV_DST_ALPHA; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_DST_ALPHA; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_DST_ALPHA; + break; + case VG_BLEND_SRC_IN: + blend->rgb_src_factor = PIPE_BLENDFACTOR_DST_ALPHA; + blend->alpha_src_factor = PIPE_BLENDFACTOR_DST_ALPHA; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + break; + case VG_BLEND_DST_IN: + blend->rgb_src_factor = PIPE_BLENDFACTOR_ZERO; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ZERO; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_SRC_ALPHA; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_SRC_ALPHA; + break; + case VG_BLEND_MULTIPLY: + case VG_BLEND_SCREEN: + case VG_BLEND_DARKEN: + case VG_BLEND_LIGHTEN: + blend->rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_ZERO; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_ZERO; + break; + case VG_BLEND_ADDITIVE: + blend->rgb_src_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_src_factor = PIPE_BLENDFACTOR_ONE; + blend->rgb_dst_factor = PIPE_BLENDFACTOR_ONE; + blend->alpha_dst_factor = PIPE_BLENDFACTOR_ONE; + break; + default: + assert(!"not implemented blend mode"); + } + cso_set_blend(ctx->cso_context, &ctx->state.g3d.blend); + } + if ((ctx->state.dirty & RASTERIZER_DIRTY)) { + struct pipe_rasterizer_state *raster = &ctx->state.g3d.rasterizer; + memset(raster, 0, sizeof(struct pipe_rasterizer_state)); + raster->gl_rasterization_rules = 1; + cso_set_rasterizer(ctx->cso_context, &ctx->state.g3d.rasterizer); + } + if ((ctx->state.dirty & VIEWPORT_DIRTY)) { + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + const VGint param_bytes = 8 * sizeof(VGfloat); + VGfloat vs_consts[8] = { + 2.f/fb->width, 2.f/fb->height, 1, 1, + -1, -1, 0, 0 + }; + struct pipe_constant_buffer *cbuf = &ctx->vs_const_buffer; + + vg_set_viewport(ctx, VEGA_Y0_BOTTOM); + + pipe_buffer_reference(&cbuf->buffer, NULL); + cbuf->buffer = pipe_buffer_create(ctx->pipe->screen, 16, + PIPE_BUFFER_USAGE_CONSTANT, + param_bytes); + + if (cbuf->buffer) { + st_no_flush_pipe_buffer_write(ctx, cbuf->buffer, + 0, param_bytes, vs_consts); + } + ctx->pipe->set_constant_buffer(ctx->pipe, PIPE_SHADER_VERTEX, 0, cbuf); + } + if ((ctx->state.dirty & VS_DIRTY)) { + cso_set_vertex_shader_handle(ctx->cso_context, + vg_plain_vs(ctx)); + } + + /* must be last because it renders to the depth buffer*/ + if ((ctx->state.dirty & DEPTH_STENCIL_DIRTY)) { + update_clip_state(ctx); + cso_set_depth_stencil_alpha(ctx->cso_context, &ctx->state.g3d.dsa); + } + + shader_set_masking(ctx->shader, ctx->state.vg.masking); + shader_set_image_mode(ctx->shader, ctx->state.vg.image_mode); + + ctx->state.dirty = NONE_DIRTY; +} + +VGboolean vg_object_is_valid(void *ptr, enum vg_object_type type) +{ + struct vg_object *obj = ptr; + if (ptr && is_aligned(obj) && obj->type == type) + return VG_TRUE; + else + return VG_FALSE; +} + +void vg_set_error(struct vg_context *ctx, + VGErrorCode code) +{ + /*vgGetError returns the oldest error code provided by + * an API call on the current context since the previous + * call to vgGetError on that context (or since the creation + of the context).*/ + if (ctx->_error == VG_NO_ERROR) + ctx->_error = code; +} + +void vg_prepare_blend_surface(struct vg_context *ctx) +{ + struct pipe_surface *dest_surface = NULL; + struct pipe_context *pipe = ctx->pipe; + struct st_framebuffer *stfb = ctx->draw_buffer; + struct st_renderbuffer *strb = stfb->strb; + + /* first finish all pending rendering */ + vgFinish(); + + dest_surface = pipe->screen->get_tex_surface(pipe->screen, + stfb->blend_texture, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + /* flip it, because we want to use it as a sampler */ + util_blit_pixels_tex(ctx->blit, + strb->texture, + 0, strb->height, + strb->width, 0, + dest_surface, + 0, 0, + strb->width, strb->height, + 0.0, PIPE_TEX_MIPFILTER_NEAREST); + + if (dest_surface) + pipe_surface_reference(&dest_surface, NULL); + + /* make sure it's complete */ + vgFinish(); +} + + +void vg_prepare_blend_surface_from_mask(struct vg_context *ctx) +{ + struct pipe_surface *dest_surface = NULL; + struct pipe_context *pipe = ctx->pipe; + struct st_framebuffer *stfb = ctx->draw_buffer; + struct st_renderbuffer *strb = stfb->strb; + + vg_validate_state(ctx); + + /* first finish all pending rendering */ + vgFinish(); + + dest_surface = pipe->screen->get_tex_surface(pipe->screen, + stfb->blend_texture, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + + /* flip it, because we want to use it as a sampler */ + util_blit_pixels_tex(ctx->blit, + stfb->alpha_mask, + 0, strb->height, + strb->width, 0, + dest_surface, + 0, 0, + strb->width, strb->height, + 0.0, PIPE_TEX_MIPFILTER_NEAREST); + + /* make sure it's complete */ + vgFinish(); + + if (dest_surface) + pipe_surface_reference(&dest_surface, NULL); +} + +void * vg_plain_vs(struct vg_context *ctx) +{ + if (!ctx->plain_vs) { + ctx->plain_vs = shader_create_from_text(ctx->pipe, + vs_plain_asm, + 200, + PIPE_SHADER_VERTEX); + } + + return ctx->plain_vs->driver; +} + + +void * vg_clear_vs(struct vg_context *ctx) +{ + if (!ctx->clear_vs) { + ctx->clear_vs = shader_create_from_text(ctx->pipe, + vs_clear_asm, + 200, + PIPE_SHADER_VERTEX); + } + + return ctx->clear_vs->driver; +} + +void * vg_texture_vs(struct vg_context *ctx) +{ + if (!ctx->texture_vs) { + ctx->texture_vs = shader_create_from_text(ctx->pipe, + vs_texture_asm, + 200, + PIPE_SHADER_VERTEX); + } + + return ctx->texture_vs->driver; +} + +void vg_set_viewport(struct vg_context *ctx, VegaOrientation orientation) +{ + struct pipe_viewport_state viewport; + struct pipe_framebuffer_state *fb = &ctx->state.g3d.fb; + VGfloat y_scale = (orientation == VEGA_Y0_BOTTOM) ? -2.f : 2.f; + + viewport.scale[0] = fb->width / 2.f; + viewport.scale[1] = fb->height / y_scale; + viewport.scale[2] = 1.0; + viewport.scale[3] = 1.0; + viewport.translate[0] = fb->width / 2.f; + viewport.translate[1] = fb->height / 2.f; + viewport.translate[2] = 0.0; + viewport.translate[3] = 0.0; + + cso_set_viewport(ctx->cso_context, &viewport); +} diff --git a/src/gallium/state_trackers/vega/vg_context.h b/src/gallium/state_trackers/vega/vg_context.h new file mode 100644 index 0000000000..ccc8889c8c --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_context.h @@ -0,0 +1,292 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef VG_CONTEXT_H +#define VG_CONTEXT_H + +#include "vg_state.h" + +#include "pipe/p_format.h" +#include "pipe/p_state.h" +#include "util/u_pointer.h" +#include "util/u_math.h" + +#include "cso_cache/cso_hash.h" +#include "cso_cache/cso_context.h" + +struct renderer; +struct shaders_cache; +struct shader; +struct vg_shader; + +struct st_renderbuffer { + enum pipe_format format; + struct pipe_surface *surface; + struct pipe_texture *texture; + VGint width, height; +}; + +struct st_framebuffer { + VGint init_width, init_height; + struct st_renderbuffer *strb; + struct st_renderbuffer *dsrb; + + struct pipe_texture *alpha_mask; + + struct pipe_texture *blend_texture; + + void *privateData; +}; + +enum vg_object_type { + VG_OBJECT_UNKNOWN = 0, + VG_OBJECT_PAINT, + VG_OBJECT_IMAGE, + VG_OBJECT_MASK, + VG_OBJECT_FONT, + VG_OBJECT_PATH, + + VG_OBJECT_LAST +}; +enum dirty_state { + NONE_DIRTY = 0<<0, + BLEND_DIRTY = 1<<1, + RASTERIZER_DIRTY = 1<<2, + VIEWPORT_DIRTY = 1<<3, + VS_DIRTY = 1<<4, + DEPTH_STENCIL_DIRTY = 1<<5, + ALL_DIRTY = BLEND_DIRTY | RASTERIZER_DIRTY | + VIEWPORT_DIRTY | VS_DIRTY | DEPTH_STENCIL_DIRTY +}; + +struct vg_context +{ + struct pipe_context *pipe; + + struct { + struct vg_state vg; + struct { + struct pipe_blend_state blend; + struct pipe_rasterizer_state rasterizer; + struct pipe_shader_state vs_state; + struct pipe_depth_stencil_alpha_state dsa; + struct pipe_framebuffer_state fb; + } g3d; + VGbitfield dirty; + } state; + + VGErrorCode _error; + + struct st_framebuffer *draw_buffer; + + struct cso_hash *owned_objects[VG_OBJECT_LAST]; + + struct { + struct pipe_shader_state vert_shader; + struct pipe_shader_state frag_shader; + struct pipe_rasterizer_state raster; + void *fs; + float vertices[4][2][4]; /**< vertex pos + color */ + } clear; + + struct { + struct pipe_constant_buffer cbuf; + struct pipe_sampler_state sampler; + + struct vg_shader *union_fs; + struct vg_shader *intersect_fs; + struct vg_shader *subtract_fs; + struct vg_shader *set_fs; + } mask; + + struct vg_shader *pass_through_depth_fs; + + struct cso_context *cso_context; + + struct pipe_buffer *stencil_quad; + VGfloat stencil_vertices[4][2][4]; + + struct renderer *renderer; + struct shaders_cache *sc; + struct shader *shader; + + struct pipe_sampler_state blend_sampler; + struct { + struct pipe_constant_buffer buffer; + void *color_matrix_fs; + } filter; + struct vg_paint *default_paint; + + struct blit_state *blit; + + struct vg_shader *plain_vs; + struct vg_shader *clear_vs; + struct vg_shader *texture_vs; + struct pipe_constant_buffer vs_const_buffer; +}; + +struct vg_object { + enum vg_object_type type; + struct vg_context *ctx; +}; +void vg_init_object(struct vg_object *obj, struct vg_context *ctx, enum vg_object_type type); +VGboolean vg_object_is_valid(void *ptr, enum vg_object_type type); + +struct vg_context *vg_create_context(struct pipe_context *pipe, + const void *visual, + struct vg_context *share); +void vg_destroy_context(struct vg_context *ctx); +struct vg_context *vg_current_context(void); +void vg_set_current_context(struct vg_context *ctx); + +VGboolean vg_context_is_object_valid(struct vg_context *ctx, + enum vg_object_type type, + void *ptr); +void vg_context_add_object(struct vg_context *ctx, + enum vg_object_type type, + void *ptr); +void vg_context_remove_object(struct vg_context *ctx, + enum vg_object_type type, + void *ptr); + +void vg_validate_state(struct vg_context *ctx); + +void vg_set_error(struct vg_context *ctx, + VGErrorCode code); + +void vg_prepare_blend_surface(struct vg_context *ctx); +void vg_prepare_blend_surface_from_mask(struct vg_context *ctx); + + +static INLINE VGboolean is_aligned_to(const void *ptr, VGbyte alignment) +{ + void *aligned = align_pointer(ptr, alignment); + return (ptr == aligned) ? VG_TRUE : VG_FALSE; +} + +static INLINE VGboolean is_aligned(const void *ptr) +{ + return is_aligned_to(ptr, 4); +} + +static INLINE void vg_shift_rectx(VGfloat coords[4], + const VGfloat *bounds, + const VGfloat shift) +{ + coords[0] += shift; + coords[2] -= shift; + if (bounds) { + coords[2] = MIN2(coords[2], bounds[2]); + /* bound x/y + width/height */ + if ((coords[0] + coords[2]) > (bounds[0] + bounds[2])) { + coords[2] = (bounds[0] + bounds[2]) - coords[0]; + } + } +} + +static INLINE void vg_shift_recty(VGfloat coords[4], + const VGfloat *bounds, + const VGfloat shift) +{ + coords[1] += shift; + coords[3] -= shift; + if (bounds) { + coords[3] = MIN2(coords[3], bounds[3]); + if ((coords[1] + coords[3]) > (bounds[1] + bounds[3])) { + coords[3] = (bounds[1] + bounds[3]) - coords[1]; + } + } +} + +static INLINE void vg_bound_rect(VGfloat coords[4], + const VGfloat bounds[4], + VGfloat shift[4]) +{ + /* if outside the bounds */ + if (coords[0] > (bounds[0] + bounds[2]) || + coords[1] > (bounds[1] + bounds[3]) || + (coords[0] + coords[2]) < bounds[0] || + (coords[1] + coords[3]) < bounds[1]) { + coords[0] = 0.f; + coords[1] = 0.f; + coords[2] = 0.f; + coords[3] = 0.f; + shift[0] = 0.f; + shift[1] = 0.f; + return; + } + + /* bound x */ + if (coords[0] < bounds[0]) { + shift[0] = bounds[0] - coords[0]; + coords[2] -= shift[0]; + coords[0] = bounds[0]; + } else + shift[0] = 0.f; + + /* bound y */ + if (coords[1] < bounds[1]) { + shift[1] = bounds[1] - coords[1]; + coords[3] -= shift[1]; + coords[1] = bounds[1]; + } else + shift[1] = 0.f; + + shift[2] = bounds[2] - coords[2]; + shift[3] = bounds[3] - coords[3]; + /* bound width/height */ + coords[2] = MIN2(coords[2], bounds[2]); + coords[3] = MIN2(coords[3], bounds[3]); + + /* bound x/y + width/height */ + if ((coords[0] + coords[2]) > (bounds[0] + bounds[2])) { + coords[2] = (bounds[0] + bounds[2]) - coords[0]; + } + if ((coords[1] + coords[3]) > (bounds[1] + bounds[3])) { + coords[3] = (bounds[1] + bounds[3]) - coords[1]; + } + + /* if outside the bounds */ + if ((coords[0] + coords[2]) < bounds[0] || + (coords[1] + coords[3]) < bounds[1]) { + coords[0] = 0.f; + coords[1] = 0.f; + coords[2] = 0.f; + coords[3] = 0.f; + return; + } +} + +void *vg_plain_vs(struct vg_context *ctx); +void *vg_clear_vs(struct vg_context *ctx); +void *vg_texture_vs(struct vg_context *ctx); +typedef enum { + VEGA_Y0_TOP, + VEGA_Y0_BOTTOM +} VegaOrientation; +void vg_set_viewport(struct vg_context *ctx, VegaOrientation orientation); + +#endif diff --git a/src/gallium/state_trackers/vega/vg_state.c b/src/gallium/state_trackers/vega/vg_state.c new file mode 100644 index 0000000000..6f6bfdaf7a --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_state.c @@ -0,0 +1,124 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "vg_state.h" + +#include <string.h> + +void vg_init_state(struct vg_state *state) +{ + state->matrix_mode = VG_MATRIX_PATH_USER_TO_SURFACE; + state->fill_rule = VG_EVEN_ODD; + state->image_quality = VG_IMAGE_QUALITY_FASTER; + state->rendering_quality = VG_RENDERING_QUALITY_BETTER; + state->blend_mode = VG_BLEND_SRC_OVER; + state->image_mode = VG_DRAW_IMAGE_NORMAL; + + memset(state->scissor_rects, 0, sizeof(state->scissor_rects)); + state->scissor_rects_num = 0; + + state->color_transform = VG_FALSE; + state->color_transform_values[0] = 1.0f; + state->color_transform_values[1] = 1.0f; + state->color_transform_values[2] = 1.0f; + state->color_transform_values[3] = 1.0f; + state->color_transform_values[4] = 0.0f; + state->color_transform_values[5] = 0.0f; + state->color_transform_values[6] = 0.0f; + state->color_transform_values[7] = 0.0f; + + /* Stroke parameters */ + state->stroke.line_width.f = 1.0f; + state->stroke.line_width.i = 1; + state->stroke.cap_style = VG_CAP_BUTT; + state->stroke.join_style = VG_JOIN_MITER; + state->stroke.miter_limit.f = 4.0f; + state->stroke.miter_limit.i = 4; + state->stroke.dash_pattern_num = 0; + state->stroke.dash_phase.f = 0.0f; + state->stroke.dash_phase.i = 0; + state->stroke.dash_phase_reset = VG_FALSE; + + /* Edge fill color for VG_TILE_FILL tiling mode */ + state->tile_fill_color[0] = 0.0f; + state->tile_fill_color[1] = 0.0f; + state->tile_fill_color[2] = 0.0f; + state->tile_fill_color[3] = 0.0f; + + /* Color for vgClear */ + state->clear_color[0] = 0.0f; + state->clear_color[1] = 0.0f; + state->clear_color[2] = 0.0f; + state->clear_color[3] = 0.0f; + + /* Glyph origin */ + state->glyph_origin[0].f = 0.0f; + state->glyph_origin[1].f = 0.0f; + state->glyph_origin[0].i = 0; + state->glyph_origin[1].i = 0; + + /* Enable/disable alpha masking and scissoring */ + state->masking = VG_FALSE; + state->scissoring = VG_FALSE; + + /* Pixel layout information */ + state->pixel_layout = VG_PIXEL_LAYOUT_UNKNOWN; + state->screen_layout = VG_PIXEL_LAYOUT_UNKNOWN; + + /* Source format selection for image filters */ + state->filter_format_linear = VG_FALSE; + state->filter_format_premultiplied = VG_FALSE; + + /* Destination write enable mask for image filters */ + state->filter_channel_mask = (VG_RED | VG_GREEN | VG_BLUE | VG_ALPHA); + + matrix_load_identity(&state->path_user_to_surface_matrix); + matrix_load_identity(&state->image_user_to_surface_matrix); + matrix_load_identity(&state->fill_paint_to_user_matrix); + matrix_load_identity(&state->stroke_paint_to_user_matrix); + matrix_load_identity(&state->glyph_user_to_surface_matrix); +} + +struct matrix *vg_state_matrix(struct vg_state *state) +{ + switch(state->matrix_mode) { + case VG_MATRIX_PATH_USER_TO_SURFACE: + return &state->path_user_to_surface_matrix; + case VG_MATRIX_IMAGE_USER_TO_SURFACE: + return &state->image_user_to_surface_matrix; + case VG_MATRIX_FILL_PAINT_TO_USER: + return &state->fill_paint_to_user_matrix; + case VG_MATRIX_STROKE_PAINT_TO_USER: + return &state->stroke_paint_to_user_matrix; +#ifdef OPENVG_VERSION_1_1 + case VG_MATRIX_GLYPH_USER_TO_SURFACE: + return &state->glyph_user_to_surface_matrix; +#endif + default: + break; + } + return NULL; +} diff --git a/src/gallium/state_trackers/vega/vg_state.h b/src/gallium/state_trackers/vega/vg_state.h new file mode 100644 index 0000000000..ed90689f91 --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_state.h @@ -0,0 +1,109 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef VG_STATE_H +#define VG_STATE_H + +#include "VG/openvg.h" + +#include "api_consts.h" +#include "matrix.h" + +struct vg_value +{ + VGfloat f; + VGint i; +}; + +struct vg_state { + /* Mode settings */ + VGMatrixMode matrix_mode; + VGFillRule fill_rule; + VGImageQuality image_quality; + VGRenderingQuality rendering_quality; + VGBlendMode blend_mode; + VGImageMode image_mode; + + /* Scissoring rectangles */ + struct vg_value scissor_rects[32*4]; + VGint scissor_rects_num; + + /* Color Transformation */ + VGboolean color_transform; + VGfloat color_transform_values[8]; + + /* Stroke parameters */ + struct { + struct vg_value line_width; + VGCapStyle cap_style; + VGJoinStyle join_style; + struct vg_value miter_limit; + struct vg_value dash_pattern[VEGA_MAX_DASH_COUNT]; + VGint dash_pattern_num; + struct vg_value dash_phase; + VGboolean dash_phase_reset; + } stroke; + + /* Edge fill color for VG_TILE_FILL tiling mode */ + VGfloat tile_fill_color[4]; + VGint tile_fill_colori[4]; + + /* Color for vgClear */ + VGfloat clear_color[4]; + VGint clear_colori[4]; + + /* Glyph origin */ + struct vg_value glyph_origin[2]; + + /* Enable/disable alpha masking and scissoring */ + VGboolean masking; + VGboolean scissoring; + + /* Pixel layout information */ + VGPixelLayout pixel_layout; + VGPixelLayout screen_layout; + + /* Source format selection for image filters */ + VGboolean filter_format_linear; + VGboolean filter_format_premultiplied; + + /* Destination write enable mask for image filters */ + VGbitfield filter_channel_mask; + + struct matrix path_user_to_surface_matrix; + struct matrix image_user_to_surface_matrix; + struct matrix fill_paint_to_user_matrix; + struct matrix stroke_paint_to_user_matrix; + struct matrix glyph_user_to_surface_matrix; + + struct vg_paint *stroke_paint; + struct vg_paint *fill_paint; +}; + +void vg_init_state(struct vg_state *state); +struct matrix * vg_state_matrix(struct vg_state *state); + +#endif diff --git a/src/gallium/state_trackers/vega/vg_tracker.c b/src/gallium/state_trackers/vega/vg_tracker.c new file mode 100644 index 0000000000..c262ce08fa --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_tracker.c @@ -0,0 +1,406 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "vg_context.h" +#include "vg_tracker.h" +#include "mask.h" + +#include "pipe/p_context.h" +#include "pipe/p_inlines.h" +#include "pipe/p_screen.h" +#include "util/u_memory.h" +#include "util/u_math.h" + +static struct pipe_texture * +create_texture(struct pipe_context *pipe, enum pipe_format format, + VGint width, VGint height) +{ + struct pipe_texture templ; + + memset(&templ, 0, sizeof(templ)); + + if (format != PIPE_FORMAT_NONE) { + templ.format = format; + } + else { + templ.format = PIPE_FORMAT_A8R8G8B8_UNORM; + } + + templ.target = PIPE_TEXTURE_2D; + pf_get_block(templ.format, &templ.block); + templ.width[0] = width; + templ.height[0] = height; + templ.depth[0] = 1; + templ.last_level = 0; + + if (pf_get_component_bits(format, PIPE_FORMAT_COMP_S)) { + templ.tex_usage = PIPE_TEXTURE_USAGE_DEPTH_STENCIL; + } else { + templ.tex_usage = (PIPE_TEXTURE_USAGE_DISPLAY_TARGET | + PIPE_TEXTURE_USAGE_RENDER_TARGET | + PIPE_TEXTURE_USAGE_SAMPLER); + } + + return pipe->screen->texture_create(pipe->screen, &templ); +} + +/** + * Allocate a renderbuffer for a an on-screen window (not a user-created + * renderbuffer). The window system code determines the format. + */ +static struct st_renderbuffer * +st_new_renderbuffer_fb(enum pipe_format format) +{ + struct st_renderbuffer *strb; + + strb = CALLOC_STRUCT(st_renderbuffer); + if (!strb) { + /*_vega_error(NULL, VG_OUT_OF_MEMORY, "creating renderbuffer");*/ + return NULL; + } + + strb->format = format; + + return strb; +} + + +/** + * This is called to allocate the original drawing surface, and + * during window resize. + */ +static VGboolean +st_renderbuffer_alloc_storage(struct vg_context * ctx, + struct st_renderbuffer *strb, + VGuint width, VGuint height) +{ + struct pipe_context *pipe = ctx->pipe; + unsigned surface_usage; + + /* Free the old surface and texture + */ + pipe_surface_reference(&strb->surface, NULL); + pipe_texture_reference(&strb->texture, NULL); + + + /* Probably need dedicated flags for surface usage too: + */ + surface_usage = (PIPE_BUFFER_USAGE_GPU_READ | + PIPE_BUFFER_USAGE_GPU_WRITE); + + strb->texture = create_texture(pipe, strb->format, + width, height); + + if (!strb->texture) + return FALSE; + + strb->surface = pipe->screen->get_tex_surface(pipe->screen, + strb->texture, + 0, 0, 0, + surface_usage); + strb->width = width; + strb->height = height; + + assert(strb->surface->width == width); + assert(strb->surface->height == height); + + return strb->surface != NULL; +} + +struct vg_context * st_create_context(struct pipe_context *pipe, + const void *visual, + struct vg_context *share) +{ + struct vg_context *ctx = vg_create_context(pipe, visual, share); + /*debug_printf("--------- CREATE CONTEXT %p\n", ctx);*/ + return ctx; +} + +void st_destroy_context(struct vg_context *st) +{ + /*debug_printf("--------- DESTROY CONTEXT %p\n", st);*/ + vg_destroy_context(st); +} + +void st_copy_context_state(struct vg_context *dst, struct vg_context *src, + uint mask) +{ + fprintf(stderr, "FIXME: %s\n", __FUNCTION__); +} + +void st_get_framebuffer_dimensions(struct st_framebuffer *stfb, + uint *width, + uint *height) +{ + *width = stfb->strb->width; + *height = stfb->strb->height; +} + +struct st_framebuffer * st_create_framebuffer(const void *visual, + enum pipe_format colorFormat, + enum pipe_format depthFormat, + enum pipe_format stencilFormat, + uint width, uint height, + void *privateData) +{ + struct st_framebuffer *stfb = CALLOC_STRUCT(st_framebuffer); + if (stfb) { + struct st_renderbuffer *rb = + st_new_renderbuffer_fb(colorFormat); + stfb->strb = rb; +#if 0 + if (doubleBuffer) { + struct st_renderbuffer *rb = + st_new_renderbuffer_fb(colorFormat); + } +#endif + + /* we want to combine the depth/stencil */ + if (stencilFormat == depthFormat) + stfb->dsrb = st_new_renderbuffer_fb(stencilFormat); + else + stfb->dsrb = st_new_renderbuffer_fb(PIPE_FORMAT_S8Z24_UNORM); + + /*### currently we always allocate it but it's possible it's + not necessary if EGL_ALPHA_MASK_SIZE was 0 + */ + stfb->alpha_mask = 0; + + stfb->init_width = width; + stfb->init_height = height; + stfb->privateData = privateData; + } + + return stfb; +} + +static void setup_new_alpha_mask(struct vg_context *ctx, + struct st_framebuffer *stfb, + uint width, uint height) +{ + struct pipe_context *pipe = ctx->pipe; + struct pipe_texture *old_texture = stfb->alpha_mask; + + /* + we use PIPE_FORMAT_A8R8G8B8_UNORM because we want to render to + this texture and use it as a sampler, so while this wastes some + space it makes both of those a lot simpler + */ + stfb->alpha_mask = + create_texture(pipe, PIPE_FORMAT_A8R8G8B8_UNORM, width, height); + + if (!stfb->alpha_mask) { + if (old_texture) + pipe_texture_reference(&old_texture, NULL); + return; + } + + vg_validate_state(ctx); + + /* alpha mask starts with 1.f alpha */ + mask_fill(0, 0, width, height, 1.f); + + /* if we had an old surface copy it over */ + if (old_texture) { + struct pipe_surface *surface = pipe->screen->get_tex_surface( + pipe->screen, + stfb->alpha_mask, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_WRITE); + struct pipe_surface *old_surface = pipe->screen->get_tex_surface( + pipe->screen, + old_texture, + 0, 0, 0, + PIPE_BUFFER_USAGE_GPU_READ); + pipe->surface_copy(pipe, + surface, + 0, 0, + old_surface, + 0, 0, + MIN2(old_surface->width, width), + MIN2(old_surface->height, height)); + if (surface) + pipe_surface_reference(&surface, NULL); + if (old_surface) + pipe_surface_reference(&old_surface, NULL); + } + + /* Free the old texture + */ + if (old_texture) + pipe_texture_reference(&old_texture, NULL); +} + +void st_resize_framebuffer(struct st_framebuffer *stfb, + uint width, uint height) +{ + struct vg_context *ctx = vg_current_context(); + struct st_renderbuffer *strb = stfb->strb; + struct pipe_framebuffer_state *state; + + if (!ctx) + return; + + state = &ctx->state.g3d.fb; + + /* If this is a noop, exit early and don't do the clear, etc below. + */ + if (strb->width == width && + strb->height == height && + state->zsbuf) + return; + + if (strb->width != width || strb->height != height) + st_renderbuffer_alloc_storage(ctx, strb, + width, height); + + if (stfb->dsrb->width != width || stfb->dsrb->height != height) + st_renderbuffer_alloc_storage(ctx, stfb->dsrb, + width, height); + + { + VGuint i; + + memset(state, 0, sizeof(struct pipe_framebuffer_state)); + + state->width = width; + state->height = height; + + state->nr_cbufs = 1; + state->cbufs[0] = strb->surface; + for (i = 1; i < PIPE_MAX_COLOR_BUFS; ++i) + state->cbufs[i] = 0; + + state->zsbuf = stfb->dsrb->surface; + + cso_set_framebuffer(ctx->cso_context, state); + } + + ctx->state.dirty |= VIEWPORT_DIRTY; + ctx->state.dirty |= DEPTH_STENCIL_DIRTY;/*to reset the scissors*/ + + ctx->pipe->clear(ctx->pipe, PIPE_CLEAR_DEPTHSTENCIL, + NULL, 0.0, 0); + + /* we need all the other state already set */ + + setup_new_alpha_mask(ctx, stfb, width, height); + + pipe_texture_reference( &stfb->blend_texture, NULL ); + stfb->blend_texture = create_texture(ctx->pipe, PIPE_FORMAT_A8R8G8B8_UNORM, + width, height); +} + +void st_set_framebuffer_surface(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_surface *surf) +{ + struct st_renderbuffer *rb = stfb->strb; + + /* unreference existing surfaces */ + pipe_surface_reference( &rb->surface, NULL ); + pipe_texture_reference( &rb->texture, NULL ); + + /* reference new ones */ + pipe_surface_reference( &rb->surface, surf ); + pipe_texture_reference( &rb->texture, surf->texture ); + + rb->width = surf->width; + rb->height = surf->height; +} + +int st_get_framebuffer_surface(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_surface **surf) +{ + struct st_renderbuffer *rb = stfb->strb; + *surf = rb->surface; + return VG_TRUE; +} + +int st_get_framebuffer_texture(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_texture **tex) +{ + struct st_renderbuffer *rb = stfb->strb; + *tex = rb->texture; + return VG_TRUE; +} + +void * st_framebuffer_private(struct st_framebuffer *stfb) +{ + return stfb->privateData; +} + +void st_unreference_framebuffer(struct st_framebuffer *stfb) +{ + /* FIXME */ +} + +void st_make_current(struct vg_context *st, + struct st_framebuffer *draw, + struct st_framebuffer *read) +{ + vg_set_current_context(st); + if (st) { + st->draw_buffer = draw; + } +} + +void st_flush(struct vg_context *st, uint pipeFlushFlags, + struct pipe_fence_handle **fence) +{ + st->pipe->flush(st->pipe, pipeFlushFlags, fence); +} + +void st_finish(struct vg_context *st) +{ + struct pipe_fence_handle *fence = NULL; + + st_flush(st, PIPE_FLUSH_RENDER_CACHE, &fence); + + st->pipe->screen->fence_finish(st->pipe->screen, fence, 0); + st->pipe->screen->fence_reference(st->pipe->screen, &fence, NULL); +} + +void st_notify_swapbuffers(struct st_framebuffer *stfb) +{ + struct vg_context *ctx = vg_current_context(); + if (ctx && ctx->draw_buffer == stfb) { + st_flush(ctx, + PIPE_FLUSH_RENDER_CACHE | + PIPE_FLUSH_SWAPBUFFERS | + PIPE_FLUSH_FRAME, + NULL); + } +} + +void st_notify_swapbuffers_complete(struct st_framebuffer *stfb) +{ +} + +int +st_set_teximage(struct pipe_texture *pt, int target) +{ + return 0; +} diff --git a/src/gallium/state_trackers/vega/vg_tracker.h b/src/gallium/state_trackers/vega/vg_tracker.h new file mode 100644 index 0000000000..805c58ccc7 --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_tracker.h @@ -0,0 +1,102 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef VG_TRACKER_H +#define VG_TRACKER_H + +#include "VG/openvg.h" + +#include "pipe/p_compiler.h" +#include "pipe/p_format.h" + +#define ST_SURFACE_FRONT_LEFT 0 +#define ST_SURFACE_BACK_LEFT 1 +#define ST_SURFACE_FRONT_RIGHT 2 +#define ST_SURFACE_BACK_RIGHT 3 +#define ST_SURFACE_DEPTH 8 + +struct vg_context; +struct st_framebuffer; +struct pipe_context; +struct pipe_fence_handle; +struct pipe_surface; + + +struct vg_context *st_create_context(struct pipe_context *pipe, + const void *visual, + struct vg_context *share); + +void st_destroy_context( struct vg_context *st ); + +void st_copy_context_state(struct vg_context *dst, struct vg_context *src, + uint mask); + +struct st_framebuffer *st_create_framebuffer(const void *visual, + enum pipe_format colorFormat, + enum pipe_format depthFormat, + enum pipe_format stencilFormat, + uint width, uint height, + void *privateData); + +void st_resize_framebuffer(struct st_framebuffer *stfb, + uint width, uint height); + +void st_set_framebuffer_surface(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_surface *surf); + +void st_get_framebuffer_dimensions( struct st_framebuffer *stfb, + uint *width, uint *height); + +int st_set_teximage(struct pipe_texture *pt, int target); + +int st_get_framebuffer_surface(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_surface **surf); + +int st_get_framebuffer_texture(struct st_framebuffer *stfb, + uint surfIndex, struct pipe_texture **tex); + +void *st_framebuffer_private(struct st_framebuffer *stfb); + +void st_unreference_framebuffer(struct st_framebuffer *stfb); + +void st_make_current(struct vg_context *st, + struct st_framebuffer *draw, + struct st_framebuffer *read); + +void st_flush(struct vg_context *st, uint pipeFlushFlags, + struct pipe_fence_handle **fence); +void st_finish(struct vg_context *st); + +void st_notify_swapbuffers(struct st_framebuffer *stfb); +void st_notify_swapbuffers_complete(struct st_framebuffer *stfb); + + +/** Generic function type */ +typedef void (*st_proc)(); + +st_proc st_get_proc_address(const char *procname); + +#endif diff --git a/src/gallium/state_trackers/vega/vg_translate.c b/src/gallium/state_trackers/vega/vg_translate.c new file mode 100644 index 0000000000..00e0764706 --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_translate.c @@ -0,0 +1,1030 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "vg_translate.h" + +#include "pipe/p_format.h" +#include "util/u_pack_color.h" + +void _vega_pack_rgba_span_float(struct vg_context *ctx, + VGuint n, VGfloat rgba[][4], + VGImageFormat dstFormat, + void *dstAddr) +{ + VGint i; + + switch (dstFormat) { + case VG_sRGBX_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = 255; + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_sRGBA_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_sRGBA_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_sRGB_565: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + r = (r / 255.0) * 32; + g = (g / 255.0) * 32; + b = (b / 255.0) * 32; + + dst[i] = b | g << 5 | r << 11; + } + return; + } + break; + case VG_sRGBA_5551: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + r = (r / 255.0) * 32; + g = (g / 255.0) * 32; + b = (b / 255.0) * 32; + a = (a / 255.0); + + dst[i] = a | b << 1 | g << 6 | r << 11; + } + return; + } + break; + case VG_sRGBA_4444: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + r = (r / 255.0) * 16; + g = (g / 255.0) * 16; + b = (b / 255.0) * 16; + a = (a / 255.0) * 16; + + dst[i] = a | b << 4 | g << 8 | r << 12; + } + return; + } + break; + case VG_sL_8: { + VGubyte *dst = (VGubyte *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + dst[i] = a; + } + return; + } + break; + case VG_lRGBX_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = 255; + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_lRGBA_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + case VG_lRGBA_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = r << 24 | g << 16 | b << 8 | a; + } + return; + } + break; + case VG_lL_8: { + VGubyte *dst = (VGubyte *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a; + } + return; + } + break; + case VG_A_8: { + VGubyte *dst = (VGubyte *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + dst[i] = a; + } + return; + } + break; + case VG_BW_1: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + VGubyte res; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + res = (r + g + b + a)/4; + dst[i] = (res & (128)); + } + return; + } + break; +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + dst[i] = (a & (128)); + } + return; + } + break; + case VG_A_4: { + VGshort *dst = (VGshort *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b, a; + VGubyte res; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + + res = a/4; + dst[i] = (res & (128)); + } + return; + } + break; +#endif + case VG_sXRGB_8888: + break; + case VG_sARGB_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | r << 16 | g << 8 | b; + } + return; + } + break; + case VG_sARGB_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | r << 16 | g << 8 | b; + } + return; + } + break; + case VG_sARGB_1555: + break; + case VG_sARGB_4444: + break; + case VG_lXRGB_8888: + break; + case VG_lARGB_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | r << 16 | g << 8 | b; + } + return; + } + break; + case VG_lARGB_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | r << 16 | g << 8 | b; + } + return; + } + break; + case VG_sBGRX_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = 0xff; + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_sBGRA_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_sBGRA_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_sBGR_565: + break; + case VG_sBGRA_5551: + break; + case VG_sBGRA_4444: + break; + case VG_lBGRX_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = 0xff; + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_lBGRA_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_lBGRA_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = b << 24 | g << 16 | r << 8 | a; + } + return; + } + break; + case VG_sXBGR_8888: + break; + case VG_sABGR_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | b << 16 | g << 8 | r; + } + return; + } + break; + case VG_sABGR_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | b << 16 | g << 8 | r; + } + return; + } + break; + case VG_sABGR_1555: + break; + case VG_sABGR_4444: + break; + case VG_lXBGR_8888: + break; + case VG_lABGR_8888: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | b << 16 | g << 8 | r; + } + return; + } + break; + case VG_lABGR_8888_PRE: { + VGint *dst = (VGint *)dstAddr; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = float_to_ubyte(rgba[i][0]); + g = float_to_ubyte(rgba[i][1]); + b = float_to_ubyte(rgba[i][2]); + a = float_to_ubyte(rgba[i][3]); + dst[i] = a << 24 | b << 16 | g << 8 | r; + } + return; + } + break; + default: + assert(!"Unknown ReadPixels format"); + break; + } + assert(!"Not implemented ReadPixels format"); +} + +void _vega_unpack_float_span_rgba(struct vg_context *ctx, + VGuint n, + VGuint offset, + const void * data, + VGImageFormat dataFormat, + VGfloat rgba[][4]) +{ + VGint i; + + switch (dataFormat) { + case VG_sRGBX_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_sRGBA_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sRGBA_8888_PRE: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sRGB_565: { + VGshort *src = (VGshort *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGfloat clr[4]; + clr[0] = ((*src >> 10) & 31)/31.; + clr[1] = ((*src >> 5) & 95)/95.; + clr[2] = ((*src >> 0) & 31)/31.; + clr[3] = 1.f; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_sRGBA_5551: { + VGshort *src = (VGshort *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGfloat clr[4]; + clr[0] = ((*src >> 10) & 31)/31.; + clr[1] = ((*src >> 5) & 31)/31.; + clr[2] = ((*src >> 1) & 31)/31.; + clr[3] = ((*src >> 0) & 1)/1.; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_sRGBA_4444: { + VGshort *src = (VGshort *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGfloat clr[4]; + clr[0] = ((*src >> 12) & 15)/15.; + clr[1] = ((*src >> 8) & 15)/15.; + clr[2] = ((*src >> 4) & 15)/15.; + clr[3] = ((*src >> 0) & 15)/15.; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_sL_8: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; ++i) { + util_pack_color_ub(0xff, 0xff, 0xff, *src, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_lRGBX_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_lRGBA_8888: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lRGBA_8888_PRE: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + r = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + b = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lL_8: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; ++i) { + util_pack_color_ub(0xff, 0xff, 0xff, *src, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_A_8: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; ++i) { + util_pack_color_ub(0xff, 0xff, 0xff, *src, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + } + return; + case VG_BW_1: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; i += 8) { + VGfloat clr[4]; + VGint j; + for (j = 0; j < 8 && j < n ; ++j) { + VGint shift = j; + clr[0] = (((*src) & (1<<shift)) >> shift); + clr[1] = clr[0]; + clr[2] = clr[0]; + clr[3] = 1.f; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i+j]); + } + ++src; + } + } + return; +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: { + VGubyte *src = (VGubyte *)data; + src += offset; + for (i = 0; i < n; i += 8) { + VGfloat clr[4]; + VGint j; + for (j = 0; j < 8 && j < n ; ++j) { + VGint shift = j; + clr[0] = 0.f; + clr[1] = 0.f; + clr[2] = 0.f; + clr[3] = (((*src) & (1<<shift)) >> shift); + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i+j]); + } + ++src; + } + } + return; + case VG_A_4: { + VGubyte *src = (VGubyte *)data; + src += offset/2; + for (i = 0; i < n; i += 2) { + VGfloat clr[4]; + VGint j; + for (j = 0; j < n && j < 2; ++j) { + VGint bitter, shift; + if (j == 0) { + bitter = 0x0f; + shift = 0; + } else { + bitter = 0xf0; + shift = 4; + } + clr[0] = 0.f; + clr[1] = 0.f; + clr[2] = 0.f; + clr[3] = ((*src) & (bitter)) >> shift; + + util_pack_color(clr, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i +j]); + } + ++src; + } + } + return; +#endif + case VG_sXRGB_8888: + break; + case VG_sARGB_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + r = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + b = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sARGB_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + r = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + b = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sARGB_1555: + break; + case VG_sARGB_4444: + break; + case VG_lXRGB_8888: + break; + case VG_lARGB_8888: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + r = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + b = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lARGB_8888_PRE: { + VGint *src = (VGint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + r = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + b = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sBGRX_8888: + break; + case VG_sBGRA_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + b = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + r = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sBGRA_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + b = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + r = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sBGR_565: + break; + case VG_sBGRA_5551: + break; + case VG_sBGRA_4444: + break; + case VG_lBGRX_8888: + break; + case VG_lBGRA_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + b = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + r = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lBGRA_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + b = (*src >> 24) & 0xff; + g = (*src >> 16) & 0xff; + r = (*src >> 8) & 0xff; + a = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sXBGR_8888: + break; + case VG_sABGR_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + b = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + r = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sABGR_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + b = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + r = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_sABGR_1555: + break; + case VG_sABGR_4444: + break; + case VG_lXBGR_8888: + break; + case VG_lABGR_8888: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + b = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + r = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + case VG_lABGR_8888_PRE: { + VGuint *src = (VGuint *)data; + src += offset; + for (i = 0; i < n; ++i) { + VGubyte r, g, b ,a; + a = (*src >> 24) & 0xff; + b = (*src >> 16) & 0xff; + g = (*src >> 8) & 0xff; + r = (*src >> 0) & 0xff; + + util_pack_color_ub(r, g, b, a, PIPE_FORMAT_R32G32B32A32_FLOAT, + rgba[i]); + ++src; + } + return; + } + break; + default: + assert(!"Unknown ReadPixels format"); + break; + } + assert(!"Not implemented ReadPixels format"); +} + +VGint _vega_size_for_format(VGImageFormat dataFormat) +{ + switch (dataFormat) { + case VG_sRGBX_8888: + case VG_sRGBA_8888: + case VG_sRGBA_8888_PRE: + return 4; + case VG_sRGB_565: + case VG_sRGBA_5551: + case VG_sRGBA_4444: + return 2; + case VG_sL_8: + return 1; + case VG_lRGBX_8888: + case VG_lRGBA_8888: + case VG_lRGBA_8888_PRE: + return 4; + case VG_lL_8: + return 1; + case VG_A_8: + return 1; + case VG_BW_1: + return 1; +#ifdef OPENVG_VERSION_1_1 + case VG_A_1: + break; + case VG_A_4: + break; +#endif + case VG_sXRGB_8888: + case VG_sARGB_8888: + case VG_sARGB_8888_PRE: + return 4; + case VG_sARGB_1555: + case VG_sARGB_4444: + return 2; + case VG_lXRGB_8888: + case VG_lARGB_8888: + case VG_lARGB_8888_PRE: + case VG_sBGRX_8888: + case VG_sBGRA_8888: + case VG_sBGRA_8888_PRE: + return 4; + case VG_sBGR_565: + case VG_sBGRA_5551: + case VG_sBGRA_4444: + return 2; + case VG_lBGRX_8888: + case VG_lBGRA_8888: + case VG_lBGRA_8888_PRE: + case VG_sXBGR_8888: + case VG_sABGR_8888: + case VG_sABGR_8888_PRE: + return 4; + case VG_sABGR_1555: + case VG_sABGR_4444: + return 2; + case VG_lXBGR_8888: + case VG_lABGR_8888: + case VG_lABGR_8888_PRE: + return 4; + default: + assert(!"Unknown ReadPixels format"); + break; + } + assert(!"Not implemented ReadPixels format"); + return 0; +} diff --git a/src/gallium/state_trackers/vega/vg_translate.h b/src/gallium/state_trackers/vega/vg_translate.h new file mode 100644 index 0000000000..70815bacbc --- /dev/null +++ b/src/gallium/state_trackers/vega/vg_translate.h @@ -0,0 +1,49 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#ifndef VG_TRANSLATE_H +#define VG_TRANSLATE_H + +#include "VG/openvg.h" +#include "vg_context.h" + +/*FIXME: we really should be using translate module + * but pipe_format can't express some of the VG formats + * (the premultiplied ones) so currently it won't work */ + +void _vega_pack_rgba_span_float(struct vg_context *ctx, + VGuint n, VGfloat rgba[][4], + VGImageFormat dstFormat, + void *dstAddr); +void _vega_unpack_float_span_rgba(struct vg_context *ctx, + VGuint n, + VGuint offset, + const void * data, + VGImageFormat dataFormat, + VGfloat rgba[][4]); +VGint _vega_size_for_format(VGImageFormat format); + +#endif diff --git a/src/gallium/state_trackers/vega/vgu.c b/src/gallium/state_trackers/vega/vgu.c new file mode 100644 index 0000000000..7dc51c5599 --- /dev/null +++ b/src/gallium/state_trackers/vega/vgu.c @@ -0,0 +1,450 @@ +/************************************************************************** + * + * Copyright 2009 VMware, Inc. All Rights Reserved. + * + * Permission is hereby granted, free of charge, to any person obtaining a + * copy of this software and associated documentation files (the + * "Software"), to deal in the Software without restriction, including + * without limitation the rights to use, copy, modify, merge, publish, + * distribute, sub license, and/or sell copies of the Software, and to + * permit persons to whom the Software is furnished to do so, subject to + * the following conditions: + * + * The above copyright notice and this permission notice (including the + * next paragraph) shall be included in all copies or substantial portions + * of the Software. + * + * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS + * OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF + * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NON-INFRINGEMENT. + * IN NO EVENT SHALL VMWARE AND/OR ITS SUPPLIERS BE LIABLE FOR + * ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, + * TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE + * SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. + * + **************************************************************************/ + +#include "VG/openvg.h" +#include "VG/vgu.h" + +#include "matrix.h" +#include "path.h" + +#include "util/u_debug.h" +#include "util/u_pointer.h" + +#include <math.h> +#include <assert.h> + +static VGboolean is_aligned_to(const void *ptr, VGbyte alignment) +{ + void *aligned = align_pointer(ptr, alignment); + return (ptr == aligned) ? VG_TRUE : VG_FALSE; +} + +static VGboolean is_aligned(const void *ptr) +{ + return is_aligned_to(ptr, 4); +} + +static void vgu_append_float_coords(VGPath path, + const VGubyte *cmds, + VGint num_cmds, + const VGfloat *coords, + VGint num_coords) +{ + VGubyte common_data[40 * sizeof(VGfloat)]; + struct path *p = (struct path *)path; + + vg_float_to_datatype(path_datatype(p), common_data, coords, num_coords); + vgAppendPathData(path, num_cmds, cmds, common_data); +} + +VGUErrorCode vguLine(VGPath path, + VGfloat x0, VGfloat y0, + VGfloat x1, VGfloat y1) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, VG_LINE_TO_ABS}; + VGfloat coords[4]; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + + coords[0] = x0; + coords[1] = y0; + coords[2] = x1; + coords[3] = y1; + + vgu_append_float_coords(path, cmds, 2, coords, 4); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguPolygon(VGPath path, + const VGfloat * points, + VGint count, + VGboolean closed) +{ + VGubyte *cmds; + VGfloat *coords; + VGbitfield caps; + VGint i; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + + if (!points || count <= 0 || !is_aligned(points)) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + + cmds = malloc(sizeof(VGubyte) * count + 1); + coords = malloc(sizeof(VGfloat) * count * 2); + + cmds[0] = VG_MOVE_TO_ABS; + coords[0] = points[0]; + coords[1] = points[1]; + for (i = 1; i < count; ++i) { + cmds[i] = VG_LINE_TO_ABS; + coords[2*i + 0] = points[2*i + 0]; + coords[2*i + 1] = points[2*i + 1]; + } + + if (closed) { + cmds[i] = VG_CLOSE_PATH; + ++i; + } + + vgu_append_float_coords(path, cmds, i, coords, 2*i); + + free(cmds); + free(coords); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguRect(VGPath path, + VGfloat x, VGfloat y, + VGfloat width, VGfloat height) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_HLINE_TO_REL, + VG_VLINE_TO_REL, + VG_HLINE_TO_REL, + VG_CLOSE_PATH + }; + VGfloat coords[5]; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + if (width <= 0 || height <= 0) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + coords[0] = x; + coords[1] = y; + coords[2] = width; + coords[3] = height; + coords[4] = -width; + + vgu_append_float_coords(path, cmds, 5, coords, 5); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguRoundRect(VGPath path, + VGfloat x, VGfloat y, + VGfloat width, + VGfloat height, + VGfloat arcWidth, + VGfloat arcHeight) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_HLINE_TO_REL, + VG_SCCWARC_TO_REL, + VG_VLINE_TO_REL, + VG_SCCWARC_TO_REL, + VG_HLINE_TO_REL, + VG_SCCWARC_TO_REL, + VG_VLINE_TO_REL, + VG_SCCWARC_TO_REL, + VG_CLOSE_PATH + }; + VGfloat c[26]; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + if (width <= 0 || height <= 0) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + c[0] = x + arcWidth/2; c[1] = y; + + c[2] = width - arcWidth; + + c[3] = arcWidth/2; c[4] = arcHeight/2; c[5] = 0; + c[6] = arcWidth/2; c[7] = arcHeight/2; + + c[8] = height - arcHeight; + + c[9] = arcWidth/2; c[10] = arcHeight/2; c[11] = 0; + c[12] = -arcWidth/2; c[13] = arcHeight/2; + + c[14] = -(width - arcWidth); + + c[15] = arcWidth/2; c[16] = arcHeight/2; c[17] = 0; + c[18] = -arcWidth/2; c[19] = -arcHeight/2; + + c[20] = -(height - arcHeight); + + c[21] = arcWidth/2; c[22] = arcHeight/2; c[23] = 0; + c[24] = arcWidth/2; c[25] = -arcHeight/2; + + vgu_append_float_coords(path, cmds, 10, c, 26); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguEllipse(VGPath path, + VGfloat cx, VGfloat cy, + VGfloat width, + VGfloat height) +{ + static const VGubyte cmds[] = {VG_MOVE_TO_ABS, + VG_SCCWARC_TO_REL, + VG_SCCWARC_TO_REL, + VG_CLOSE_PATH + }; + VGfloat coords[12]; + VGbitfield caps; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + if (width <= 0 || height <= 0) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + coords[0] = cx + width/2; coords[1] = cy; + + coords[2] = width/2; coords[3] = height/2; coords[4] = 0; + coords[5] = -width; coords[6] = 0; + + coords[7] = width/2; coords[8] = height/2; coords[9] = 0; + coords[10] = width; coords[11] = 0; + + vgu_append_float_coords(path, cmds, 4, coords, 11); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguArc(VGPath path, + VGfloat x, VGfloat y, + VGfloat width, VGfloat height, + VGfloat startAngle, + VGfloat angleExtent, + VGUArcType arcType) +{ + VGubyte cmds[11]; + VGfloat coords[40]; + VGbitfield caps; + VGfloat last = startAngle + angleExtent; + VGint i, c = 0; + + if (path == VG_INVALID_HANDLE) { + return VGU_BAD_HANDLE_ERROR; + } + caps = vgGetPathCapabilities(path); + if (!(caps & VG_PATH_CAPABILITY_APPEND_TO)) { + return VGU_PATH_CAPABILITY_ERROR; + } + if (width <= 0 || height <= 0) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + if (arcType != VGU_ARC_OPEN && + arcType != VGU_ARC_CHORD && + arcType != VGU_ARC_PIE) { + return VGU_ILLEGAL_ARGUMENT_ERROR; + } + + cmds[c] = VG_MOVE_TO_ABS; ++c; + coords[0] = x+cos(DEGREES_TO_RADIANS(startAngle))*width/2; + coords[1] = y+sin(DEGREES_TO_RADIANS(startAngle))*height/2; +#ifdef DEBUG_VGUARC + debug_printf("start [%f, %f]\n", coords[0], coords[1]); +#endif + i = 2; + if (angleExtent > 0) { + VGfloat angle = startAngle + 180; + while (angle < last) { + cmds[c] = VG_SCCWARC_TO_ABS; ++c; + coords[i] = width/2; coords[i+1] = height/2; coords[i+2] = 0; + coords[i+3] = x + cos(DEGREES_TO_RADIANS(angle))*width/2; + coords[i+4] = y + sin(DEGREES_TO_RADIANS(angle))*height/2; +#ifdef DEBUG_VGUARC + debug_printf("1 [%f, %f]\n", coords[i+3], + coords[i+4]); +#endif + i += 5; + angle += 180; + } + cmds[c] = VG_SCCWARC_TO_ABS; ++c; + coords[i] = width/2; coords[i+1] = height/2; coords[i+2] = 0; + coords[i+3] = x+cos(DEGREES_TO_RADIANS(last))*width/2; + coords[i+4] = y+sin(DEGREES_TO_RADIANS(last))*height/2; +#ifdef DEBUG_VGUARC + debug_printf("2 [%f, %f]\n", coords[i+3], + coords[i+4]); +#endif + i += 5; + } else { + VGfloat angle = startAngle - 180; + while (angle > last) { + cmds[c] = VG_SCWARC_TO_ABS; ++c; + coords[i] = width/2; coords[i+1] = height/2; coords[i+2] = 0; + coords[i+3] = x + cos(DEGREES_TO_RADIANS(angle)) * width/2; + coords[i+4] = y + sin(DEGREES_TO_RADIANS(angle)) * height/2; +#ifdef DEBUG_VGUARC + debug_printf("3 [%f, %f]\n", coords[i+3], + coords[i+4]); +#endif + angle -= 180; + i += 5; + } + cmds[c] = VG_SCWARC_TO_ABS; ++c; + coords[i] = width/2; coords[i+1] = height/2; coords[i+2] = 0; + coords[i+3] = x + cos(DEGREES_TO_RADIANS(last)) * width/2; + coords[i+4] = y + sin(DEGREES_TO_RADIANS(last)) * height/2; +#ifdef DEBUG_VGUARC + debug_printf("4 [%f, %f]\n", coords[i+3], + coords[i+4]); +#endif + i += 5; + } + + if (arcType == VGU_ARC_PIE) { + cmds[c] = VG_LINE_TO_ABS; ++c; + coords[i] = x; coords[i + 1] = y; + i += 2; + } + if (arcType == VGU_ARC_PIE || arcType == VGU_ARC_CHORD) { + cmds[c] = VG_CLOSE_PATH; + ++c; + } + + assert(c < 11); + + vgu_append_float_coords(path, cmds, c, coords, i); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguComputeWarpQuadToSquare(VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + VGfloat * matrix) +{ + struct matrix mat; + + if (!matrix || !is_aligned(matrix)) + return VGU_ILLEGAL_ARGUMENT_ERROR; + + if (!matrix_quad_to_square(sx0, sy0, + sx1, sy1, + sx2, sy2, + sx3, sy3, + &mat)) + return VGU_BAD_WARP_ERROR; + + if (!matrix_is_invertible(&mat)) + return VGU_BAD_WARP_ERROR; + + memcpy(matrix, mat.m, sizeof(VGfloat) * 9); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguComputeWarpSquareToQuad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2, + VGfloat dx3, VGfloat dy3, + VGfloat * matrix) +{ + struct matrix mat; + + if (!matrix || !is_aligned(matrix)) + return VGU_ILLEGAL_ARGUMENT_ERROR; + + if (!matrix_square_to_quad(dx0, dy0, + dx1, dy1, + dx2, dy2, + dx3, dy3, + &mat)) + return VGU_BAD_WARP_ERROR; + + if (!matrix_is_invertible(&mat)) + return VGU_BAD_WARP_ERROR; + + memcpy(matrix, mat.m, sizeof(VGfloat) * 9); + + return VGU_NO_ERROR; +} + +VGUErrorCode vguComputeWarpQuadToQuad(VGfloat dx0, VGfloat dy0, + VGfloat dx1, VGfloat dy1, + VGfloat dx2, VGfloat dy2, + VGfloat dx3, VGfloat dy3, + VGfloat sx0, VGfloat sy0, + VGfloat sx1, VGfloat sy1, + VGfloat sx2, VGfloat sy2, + VGfloat sx3, VGfloat sy3, + VGfloat * matrix) +{ + struct matrix mat; + + if (!matrix || !is_aligned(matrix)) + return VGU_ILLEGAL_ARGUMENT_ERROR; + + if (!matrix_quad_to_quad(dx0, dy0, + dx1, dy1, + dx2, dy2, + dx3, dy3, + sx0, sy0, + sx1, sy1, + sx2, sy2, + sx3, sy3, + &mat)) + return VGU_BAD_WARP_ERROR; + + memcpy(matrix, mat.m, sizeof(VGfloat) * 9); + + return VGU_NO_ERROR; +} |